spacer

EBI Dbfetch

ID   AF343002; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AF343002;
XX
DT   05-FEB-2001 (Rel. 66, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*GCASS allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Greville W.D., Chapman G., Le T., Hogbin J.-P., Dunckley H.;
RT   "Novel HLA-DRB1 allele detected by PCR-RFLP";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Greville W.D., Chapman G., Le T., Hogbin J.-P., Dunckley H.;
RT   ;
RL   Submitted (25-JAN-2001) to the INSDC.
RL   Molecular Genetics Laboratory, Tissue Typing Services, Australian Red Cross
RL   Blood Service, 153 Clarence Street, Sydney, NSW 2000, Australia
XX
DR   MD5; 2afcab66f6350d0ab1abf7e7c8bdbeb3.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /note="exon 2"
FT                   /db_xref="GOA:Q9BD24"
FT                   /db_xref="IMGT/HLA:DRB1*03:19"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9BD24"
FT                   /protein_id="AAK01305.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDILEQKRGRVDNYCRHNYGVVESFTVQRR"
XX
SQ   Sequence 270 BP; 60 A; 63 C; 98 G; 49 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggtacctgga cagatacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacatcct ggagcagaag cggggccggg tggacaacta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer