spacer

EBI Dbfetch

ID   AF339884; SV 1; linear; genomic DNA; STD; HUM; 255 BP.
XX
AC   AF339884;
XX
DT   29-MAR-2001 (Rel. 67, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*04RCH28 allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-255
RA   Tang J., Kaslow R.A., Wilson C.M.;
RT   "Detection of an HLA class II DRB1 allele most closely related to DRB1*1402
RT   and *1420";
RL   Unpublished.
XX
RN   [2]
RP   1-255
RA   Tang J., Kaslow R.A., Wilson C.M.;
RT   ;
RL   Submitted (23-JAN-2001) to the INSDC.
RL   Geographic Medicine, University of Alabama at Birmingham, 845 19th Street
RL   South, Birmingham, AL 35294, USA
XX
DR   MD5; 7c5ba3f2f1b79fbf5235464f5f2d8d9f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..255
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            <1..>255
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   mRNA            <1..>255
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>255
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q9BCQ2"
FT                   /db_xref="IMGT/HLA:DRB1*14:41"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9BCQ2"
FT                   /protein_id="AAK26615.1"
FT                   /translation="EYSTSECHFFNGTERVRFLERYFHNQEEFLRFDSDVGEYRAVTEL
FT                   GRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQ"
XX
SQ   Sequence 255 BP; 53 A; 62 C; 93 G; 47 T; 0 other;
     tggagtactc tacgtctgag tgtcatttct tcaatgggac ggagcgggtg cggttcctgg        60
     agagatactt ccataaccag gaggagttcc tgcgcttcga cagcgacgtg ggggagtacc       120
     gggcggtgac ggagctgggg cggcctgatg ccgagtactg gaacagccag aaggacctcc       180
     tggagcagag gcgggccgcg gtggacacct actgcagaca caactacggg gttggtgaga       240
     gcttcacagt gcagc                                                        255
//


spacer
spacer