spacer

EBI Dbfetch

ID   AH010571; SV 2; linear; genomic DNA; STD; HUM; 2223 BP.
XX
AC   AH010571; AF336083-AF336084;
XX
DT   30-JUN-2011 (Rel. 109, Created)
DT   30-JUN-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I chain-related protein A (MICA) gene, MICA*002
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2223
RX   DOI; 10.1034/j.1399-0039.2001.057006520.x.
RX   PUBMED; 11556982.
RA   Obuchi N., Takahashi M., Nouchi T., Satoh M., Arimura T., Ueda K., Akai J.,
RA   Ota M., Naruse T., Inoko H., Numano F., Kimura A.;
RT   "Identification of MICA alleles with a long Leu-repeat in the transmembrane
RT   region and no cytoplasmic tail due to a frameshift-deletion in exon 4";
RL   Tissue Antigens 57(6):520-535(2001).
XX
RN   [2]
RP   1-2223
RA   Obuchi N., Kimura A.;
RT   ;
RL   Submitted (16-JAN-2001) to the INSDC.
RL   3rd Department of Internal Medicine, Tokyo Medical and Dental University,
RL   1-3-45 Yushima, Bunkyou-Ku, Tokyo 113-8519, Japan
XX
DR   Ensembl-Gn; ENSG00000183214; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235233; homo_sapiens.
DR   Ensembl-Tr; ENST00000400325; homo_sapiens.
DR   Ensembl-Tr; ENST00000418465; homo_sapiens.
DR   Ensembl-Tr; ENST00000547609; homo_sapiens.
DR   IMGT/LIGM; AH010571.
XX
CC   On or before Jun 29, 2011 this sequence version replaced
CC   gi:13445646, gi:13445647, gi:13445645.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2223
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="AMAI"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2223
FT                   /gene="MICA"
FT                   /allele="MICA*002"
FT                   /note="differs from the MICA*002 allele from the YAR cell
FT                   line by one nucleotide in intron 3"
FT   mRNA            join(<1..255,530..817,1405..1683,1784..1930,2038..>2223)
FT                   /gene="MICA"
FT                   /allele="MICA*002"
FT                   /product="MHC class I chain-related protein A"
FT   CDS             join(<1..255,530..817,1405..1683,1784..1930,2038..2165)
FT                   /codon_start=3
FT                   /gene="MICA"
FT                   /allele="MICA*002"
FT                   /product="MHC class I chain-related protein A"
FT                   /db_xref="GOA:Q29983"
FT                   /db_xref="HGNC:HGNC:7090"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1B3J"
FT                   /db_xref="PDB:1HYR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29983"
FT                   /protein_id="AAK26323.1"
FT                   /translation="PHSLRYNLTVLSGDGSVQSGFLAEVHLDGQPFLRCDRQKCRAKPQ
FT                   GQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTR
FT                   SSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADC
FT                   LQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSL
FT                   SHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQS
FT                   HWQTFHVSAVAAAAAAAAAIFVIIIFYVCCCKKKTSAAEGPELVSLQVLDQHPVGTSDH
FT                   RDATQLGFQPLMSDLGSTGSTEGA"
FT   exon            1..255
FT                   /gene="MICA"
FT                   /allele="MICA*002"
FT                   /number=2
FT   exon            530..817
FT                   /gene="MICA"
FT                   /allele="MICA*002"
FT                   /number=3
FT   exon            1405..1683
FT                   /gene="MICA"
FT                   /allele="MICA*002"
FT                   /number=4
FT   exon            1784..1930
FT                   /gene="MICA"
FT                   /allele="MICA*002"
FT                   /number=5
FT   gap             1938..2037
FT                   /estimated_length=unknown
FT   exon            2038..>2223
FT                   /gene="MICA"
FT                   /allele="MICA*002"
FT                   /number=6
FT   3'UTR           2166..>2223
FT                   /gene="MICA"
FT                   /allele="MICA*002"
XX
SQ   Sequence 2223 BP; 479 A; 568 C; 637 G; 439 T; 100 other;
     AGCCCCACAG TCTTCGTTAT AACCTCACGG TGCTGTCCGG GGATGGATCT GTGCAGTCAG        60
     GGTTTCTCGC TGAGGTACAT CTGGATGGTC AGCCCTTCCT GCGCTGTGAC AGGCAGAAAT       120
     GCAGGGCAAA GCCCCAGGGA CAGTGGGCAG AAGATGTCCT GGGAAATAAG ACATGGGACA       180
     GAGAGACCAG GGACTTGACA GGGAACGGAA AGGACCTCAG GATGACCCTG GCTCATATCA       240
     AGGACCAGAA AGAAGGTGAG AGTCGGCAGG GGCAAGAGTG ACTGGAGAGG CCTTTTCCAG       300
     AAAAGTTAGG GGCAGAGAGC AGGGACCTGT ATCTACCCAC TGGATCTGGC TCAGGCTGGG       360
     GGTGAGGAAT GGGGGTCAGT GGAACTCAGC AGGGAGGTGA GCCGGCACTC AGCCCACACA       420
     GGGAGGCATG GAGGAGGGCC AGGGAGGCGT ACCCCCTGGG CTGAGTTCCT CACTTGGGTG       480
     GAAAGGTGAT GGGTTCGGGA ATGGAGAAGT CACTGCTGGG TGGGGGCAGG CTTGCATTCC       540
     CTCCAGGAGA TTAGGGTCTG TGAGATCCAT GAAGACAACA GCACCAGGAG CTCCCAGCAT       600
     TTCTACTACG ATGGGGAGCT CTTCCTCTCC CAAAACCTGG AGACTGAGGA ATGGACAATG       660
     CCCCAGTCCT CCAGAGCTCA GACCTTGGCC ATGAACGTCA GGAATTTCTT GAAGGAAGAT       720
     GCCATGAAGA CCAAGACACA CTATCACGCT ATGCATGCAG ACTGCCTGCA GGAACTACGG       780
     CGATATCTAA AATCCGGCGT AGTCCTGAGG AGAACAGGTA CCGACGCTGG CCAGGGGCTC       840
     TCCTCTCCCT CCAATTCTGC TAGAGTTGCC TCACCTCCCA GATGTGTCCA GGGAAACCCT       900
     CCCTGTGCTA TGGATGAAGG CATTTCCTGT TGGCACATCG TGTCCTGATT TTCCTCTATT       960
     GTTAGAGCCA CTGGATAAAG ACAGTGGGTC AGGGACTGGA CCATCCAGTG TTGTAATCAG      1020
     GGCAAGTAGA GGACCCTCCG ACAGAATCCT GAGCCTGGGG TGGGTGTCAG GCAGGAGAGG      1080
     AAGGCTTCAG GGCCAGGGCT GCCCCCTCTG CCTCCCAGCC TGCCCATCCT GGAGAGTTCC      1140
     CTCCTGGCCC CACAACCCAG GAGTCCACCC CTGACATCCC CCTCCTCAGC ATCAATGTGG      1200
     GGATCCCAGA GCCTGAGGCC ACAGTCCCAT GGCCCATCCT CCTGCCAGCC TGGAAGAACT      1260
     GGGCCCCAGA GTGAGGACAG ACTTGCAGGT CAGGGGTCCC AGAGGGCTTC AGCCAGAGTG      1320
     AGAACAGTGA AGAGAAACAG CCCTGTTCCT CTCCCCTCCT TAGAGGGGAG CAGGGCTTCA      1380
     CTGGCTCTGC CCTTTCTTCT CCAGTGCCCC CCATGGTGAA TGTCACCCGC AGCGAGGCCT      1440
     CAGAGGGCAA CATTACCGTG ACATGCAGGG CTTCTGGCTT CTATCCCTGG AATATCACAC      1500
     TGAGCTGGCG TCAGGATGGG GTATCTTTGA GCCACGACAC CCAGCAGTGG GGGGATGTCC      1560
     TGCCTGATGG GAATGGAACC TACCAGACCT GGGTGGCCAC CAGGATTTGC CAAGGAGAGG      1620
     AGCAGAGGTT CACCTGCTAC ATGGAACACA GCGGGAATCA CAGCACTCAC CCTGTGCCCT      1680
     CTGGTGAGCC TAGGGTGACC CTGGAGAGGG TCAGGCCAGG GTAGGGACAG CAGGGATGGC      1740
     TGTGGCTCTC TGCCCAGTGT ATAACAAGTC CCTTTTTTTT CAGGGAAAGT GCTGGTGCTT      1800
     CAGAGTCATT GGCAGACATT CCATGTTTCT GCTGTTGCTG CTGCTGCTGC TGCTGCTGCT      1860
     GCTATTTTTG TTATTATTAT TTTCTACGTC TGTTGTTGTA AGAAGAAAAC ATCAGCTGCA      1920
     GAGGGTCCAG GTGAGAANNN NNNNNNNNNN NNNNNNNNNN NNNNNNNNNN NNNNNNNNNN      1980
     NNNNNNNNNN NNNNNNNNNN NNNNNNNNNN NNNNNNNNNN NNNNNNNNNN NNNNNNNAGC      2040
     TCGTGAGCCT GCAGGTCCTG GATCAACACC CAGTTGGGAC GAGTGACCAC AGGGATGCCA      2100
     CACAGCTCGG ATTTCAGCCT CTGATGTCAG ATCTTGGGTC CACTGGCTCC ACTGAGGGCG      2160
     CCTAGACTCT ACAGCCAGGC AGCTGGGATT CAATTCCCTG CCTGGATCTC ACGAGCACTT      2220
     TCC                                                                    2223
//



spacer
spacer