spacer

EBI Dbfetch

ID   AH010561; SV 2; linear; genomic DNA; STD; HUM; 2225 BP.
XX
AC   AH010561; AF336077-AF336078;
XX
DT   30-JUN-2011 (Rel. 109, Created)
DT   30-JUN-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I chain-related protein A (MICA) gene, MICA*018
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2225
RX   DOI; 10.1034/j.1399-0039.2001.057006520.x.
RX   PUBMED; 11556982.
RA   Obuchi N., Takahashi M., Nouchi T., Satoh M., Arimura T., Ueda K., Akai J.,
RA   Ota M., Naruse T., Inoko H., Numano F., Kimura A.;
RT   "Identification of MICA alleles with a long Leu-repeat in the transmembrane
RT   region and no cytoplasmic tail due to a frameshift-deletion in exon 4";
RL   Tissue Antigens 57(6):520-535(2001).
XX
RN   [2]
RP   1-2225
RA   Obuchi N., Kimura A.;
RT   ;
RL   Submitted (16-JAN-2001) to the INSDC.
RL   3rd Department of Internal Medicine, Tokyo and Medical and Dental
RL   University, 1-3-45 Yushima, Bunkyou-Ku, Tokyo 113-8519, Japan
XX
DR   Ensembl-Gn; ENSG00000183214; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235233; homo_sapiens.
DR   Ensembl-Tr; ENST00000400325; homo_sapiens.
DR   Ensembl-Tr; ENST00000418465; homo_sapiens.
DR   Ensembl-Tr; ENST00000547609; homo_sapiens.
DR   IMGT/LIGM; AH010561.
XX
CC   On or before Jun 29, 2011 this sequence version replaced
CC   gi:13378041, gi:13378042, gi:13378040.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2225
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="BM16"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2225
FT                   /gene="MICA"
FT                   /allele="MICA*018"
FT   mRNA            join(<1..255,530..817,1405..1683,1784..1915,2046..>2225)
FT                   /gene="MICA"
FT                   /allele="MICA*018"
FT                   /product="MHC class I chain-related protein A"
FT   CDS             join(<1..255,530..817,1405..1683,1784..1915,2046..2173)
FT                   /codon_start=3
FT                   /gene="MICA"
FT                   /allele="MICA*018"
FT                   /product="MHC class I chain-related protein A"
FT                   /note="similar to protein encoded by GenBank Accession
FT                   Number AF097404"
FT                   /db_xref="GOA:Q29983"
FT                   /db_xref="HGNC:HGNC:7090"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1B3J"
FT                   /db_xref="PDB:1HYR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29983"
FT                   /protein_id="AAK20898.1"
FT                   /translation="PHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQ
FT                   GQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTR
FT                   SSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADC
FT                   LQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSL
FT                   SHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQS
FT                   HWQTFHVSAVAAAAIFVIIIFYVRCCKKKTSAAEGPELVSLQVLDQHPVGTSDHRDATQ
FT                   LGFQPLMSDLGSTGSTEGT"
FT   exon            1..255
FT                   /gene="MICA"
FT                   /allele="MICA*018"
FT                   /number=2
FT   exon            530..817
FT                   /gene="MICA"
FT                   /allele="MICA*018"
FT                   /number=3
FT   exon            1405..1683
FT                   /gene="MICA"
FT                   /allele="MICA*018"
FT                   /number=4
FT   exon            1784..1915
FT                   /gene="MICA"
FT                   /allele="MICA*018"
FT                   /number=5
FT   gap             1916..2015
FT                   /estimated_length=unknown
FT   exon            2046..>2225
FT                   /gene="MICA"
FT                   /allele="MICA*018"
FT                   /number=6
FT   3'UTR           2174..>2225
FT                   /gene="MICA"
FT                   /allele="MICA*018"
XX
SQ   Sequence 2225 BP; 480 A; 572 C; 629 G; 444 T; 100 other;
     agccccacag tcttcgttat aacctcacgg tgctgtcctg ggatggatct gtgcagtcag        60
     ggtttctcac tgaggtacat ctggatggtc agcccttcct gcgctgtgac aggcagaaat       120
     gcagggcaaa gccccaggga cagtgggcag aagatgtcct gggaaataag acatgggaca       180
     gagagaccag agacttgaca gggaacggaa aggacctcag gatgaccctg gctcatatca       240
     aggaccagaa agaaggtgag agtcggcagg ggcaagagtg actggagagg ccttttccag       300
     aaaagttagg ggcagagagc agggacctgt ctcttcccac tggatctggc tcaggctggg       360
     ggtgaggaat gggggtcagt ggaactcagc agggaggtga gccggcactc agcccacaca       420
     gggaggcatg ggggagggcc agggaggcgt accccctggg ctgagttcct cacttgggtg       480
     gaaaggtgat gggttcggga atggagaagt cactgctggg tgggggcagg cttgcattcc       540
     ctccaggaga ttagggtctg tgagatccat gaagacaaca gcaccaggag ctcccagcat       600
     ttctactacg atggggagct cttcctctcc caaaacctgg agactgagga atggacaatg       660
     ccccagtcct ccagagctca gaccttggcc atgaacgtca ggaatttctt gaaggaagat       720
     gccatgaaga ccaagacaca ctatcacgct atgcatgcag actgcctgca ggaactacgg       780
     cgatatctaa aatccggcgt agtcctgagg agaacaggta ccgacgctgg ccaggggctc       840
     tcctctccct ccaattctgc tagagttgcc tcacctccca gatgtgtcca gggaaaccct       900
     ccctgtgcta tggatgaagg catttcctgt tggcacatcg tgtcctgatt ttcctctatt       960
     gttagagcca ctggataaag acagtgggtc agggactgga ccatccagtg ttgtaatcag      1020
     ggcaagtaga ggaccctccg acagaatcct gagcctgggg tgggtgtcag gcaggagagg      1080
     aaggcttcag ggccagggct gccccctctg cctcccagcc tgcccatcct ggagagttcc      1140
     ctcctggccc cacaacccag gagtccaccc ctgacatccc cctcctcagc atcaatgtgg      1200
     ggatcccaga gcctgaggcc acagtcccat ggcccatcct cctgccagcc tggaagaact      1260
     gggccccaga gtgaggacag acttgcaggt caggggtccc agagggcttc agccagagtg      1320
     agaacagtga agagaaacag ccctgttcct ctcccctcct tagaggggag cagggcttca      1380
     ctggctctgc cctttcttct ccagtgcccc ccatggtgaa tgtcacccgc agcgaggcct      1440
     cagagggcaa cattaccgtg acatgcaggg cttctggctt ctatccctgg aatatcacac      1500
     tgagctggcg tcaggatggg gtatctttga gccacgacac ccagcagtgg ggggatgtcc      1560
     tgcctgatgg gaatggaacc taccagacct gggtggccac caggatttgc caaggagagg      1620
     agcagaggtt cacctgctac atggaacaca gcgggaatca cagcactcac cctgtgccct      1680
     ctggtgagcc tagggtgacc ctggagaggg tcaggccagg gtagggacag cagggatggc      1740
     tgtggctctc tgcccagtgt ataacaagtc cctttttttt cagggaaagt gctggtgctt      1800
     cagagtcatt ggcagacatt ccatgtttct gctgttgctg ctgctgctat ttttgttatt      1860
     attattttct atgtccgttg ttgtaagaag aaaacatcag ctgcagaggg tccagnnnnn      1920
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1980
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnagcat ttacccgttt ccctcttttc      2040
     tccagagctc gtgagcctgc aggtcctgga tcaacaccca gttgggacga gtgaccacag      2100
     ggatgccaca cagctcggat ttcagcctct gatgtcagat cttgggtcca ctggctccac      2160
     tgagggcacc tagactctac agccaggcag ctgggattca attccctgcc tggatctcac      2220
     gagca                                                                  2225
//


spacer
spacer