spacer

EBI Dbfetch

ID   AH010560; SV 2; linear; genomic DNA; STD; HUM; 2268 BP.
XX
AC   AH010560; AF336075-AF336076;
XX
DT   30-JUN-2011 (Rel. 109, Created)
DT   30-JUN-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I chain-related protein A (MICA) gene, MICA*016
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2268
RX   DOI; 10.1034/j.1399-0039.2001.057006520.x.
RX   PUBMED; 11556982.
RA   Obuchi N., Takahashi M., Nouchi T., Satoh M., Arimura T., Ueda K., Akai J.,
RA   Ota M., Naruse T., Inoko H., Numano F., Kimura A.;
RT   "Identification of MICA alleles with a long Leu-repeat in the transmembrane
RT   region and no cytoplasmic tail due to a frameshift-deletion in exon 4";
RL   Tissue Antigens 57(6):520-535(2001).
XX
RN   [2]
RP   1-2268
RA   Obuchi N., Kimura A.;
RT   ;
RL   Submitted (16-JAN-2001) to the INSDC.
RL   3rd Department of Internal Medicine, Tokyo and Medical and Dental
RL   University, 1-3-45 Yushima, Bunkyou-Ku, Tokyo 113-8519, Japan
XX
DR   Ensembl-Gn; ENSG00000183214; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235233; homo_sapiens.
DR   Ensembl-Tr; ENST00000400325; homo_sapiens.
DR   Ensembl-Tr; ENST00000418465; homo_sapiens.
DR   Ensembl-Tr; ENST00000547609; homo_sapiens.
DR   IMGT/LIGM; AH010560.
XX
CC   On or before Jun 29, 2011 this sequence version replaced
CC   gi:13378037, gi:13378038, gi:13378036.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2268
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="TISI"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2268
FT                   /gene="MICA"
FT                   /allele="MICA*016"
FT   mRNA            join(<23..277,552..839,1427..1705,1805..1939,2079..>2268)
FT                   /gene="MICA"
FT                   /allele="MICA*016"
FT                   /product="MHC class I chain-related protein A"
FT   CDS             join(<23..277,552..839,1427..1705,1805..1939,2079..2206)
FT                   /codon_start=3
FT                   /gene="MICA"
FT                   /allele="MICA*016"
FT                   /product="MHC class I chain-related protein A"
FT                   /note="similar to protein encoded by GenBank Accession
FT                   Number U56955"
FT                   /db_xref="GOA:Q29983"
FT                   /db_xref="HGNC:HGNC:7090"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1B3J"
FT                   /db_xref="PDB:1HYR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29983"
FT                   /protein_id="AAK20897.1"
FT                   /translation="PHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQ
FT                   GQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTR
FT                   SSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADC
FT                   LQELRRYLESSVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGLSL
FT                   SHDTQQWGDVLPDGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQS
FT                   HWQTFHVSAVAAAAAIFVIIIFYVRCCKKKTSAAEGPELVSLQVLDQHPVGTSDHRDAT
FT                   QLGFQPLMSALGSTGSTEGA"
FT   exon            23..277
FT                   /gene="MICA"
FT                   /allele="MICA*016"
FT                   /number=2
FT   exon            552..839
FT                   /gene="MICA"
FT                   /allele="MICA*016"
FT                   /number=3
FT   exon            1427..1705
FT                   /gene="MICA"
FT                   /allele="MICA*016"
FT                   /number=4
FT   exon            1805..1939
FT                   /gene="MICA"
FT                   /allele="MICA*016"
FT                   /number=5
FT   gap             1947..2046
FT                   /estimated_length=unknown
FT   exon            2079..>2268
FT                   /gene="MICA"
FT                   /allele="MICA*016"
FT                   /number=6
FT   3'UTR           2207..>2268
FT                   /gene="MICA"
FT                   /allele="MICA*016"
XX
SQ   Sequence 2268 BP; 483 A; 589 C; 639 G; 457 T; 100 other;
     cctgtgattt cctcttcccc agagccccac agtcttcgtt ataacctcac ggtgctgtcc        60
     tgggatggat ctgtgcagtc agggtttctt gctgaggtac atctggatgg tcagcccttc       120
     ctgcgctatg acaggcagaa atgcagggca aagccccagg gacagtgggc agaagatgtc       180
     ctgggaaata agacatggga cagagagacc agggacttga cagggaacgg aaaggacctc       240
     aggatgaccc tggctcatat caaggaccag aaagaaggtg agagtcggca ggggcaagag       300
     tgactggaga ggccttttcc agaaaagtta ggggcagaga gcagggacct gtctcttccc       360
     actggatctg gctcaggctg ggggtgagga atgggggtca gtggaactca gcagggaggt       420
     gagccggcac tcagcccaca cagggaggca tggaggaggg ccagggaggc gtaccccctg       480
     ggctgagttc ctcacttggg tggaaaggtg atgggttcgg gaatggagaa gtcactgctg       540
     ggtgggggca ggcttgcatt ccctccagga gattagggtc tgtgagatcc atgaagacaa       600
     cagcaccagg agctcccagc atttctacta cgatggggag ctcttcctct cccaaaacct       660
     ggagactgag gaatggacag tgccccagtc ctccagagct cagaccttgg ccatgaacgt       720
     caggaatttc ttgaaggaag atgccatgaa gaccaagaca cactatcacg ctatgcatgc       780
     agactgcctg caggaactac ggcgatatct agaatccagc gtagtcctga ggagaacagg       840
     taccgacgct ggccaggggc tctcctctcc ctccaattct gctagagttg cctcacctcc       900
     cagatgtgtc cagggaaacc ctccctgtgc tatggatgaa ggcatttcct gttggcacat       960
     cgtgtcctga ttttcctcta ttgttagagc cactggataa agacagtggg tcagggactg      1020
     gaccatccag tgttgtaatc agggcaagta gaggaccctc cgacagaatc ctgagcctgg      1080
     ggtgggtgtc aggcaggaga ggaaggcttc agggccaggg ctgccccctc tgcctcccag      1140
     cctgcccatc ctggagagtt ccctcctggc cccacaaccc aggagtccac ccctgacatc      1200
     cccctcctca gcatcaatgt ggggatccca gagcctgagg ccacagtccc atggcccatc      1260
     ctcctgccag cctggaagaa ctgggcccca gagtgaggac agacttgcag gtcaggggtc      1320
     ccggagggct tcagccagag tgagaacagt gaagagaaac agccctgttc ctctcccctc      1380
     cttagagggg agcagggctt cactggctct gccctttgtt ctccagtgcc ccccatggtg      1440
     aatgtcaccc gcagcgaggc ctcagagggc aacatcaccg tgacatgcag ggcttccagc      1500
     ttctatcccc ggaatatcat actgacctgg cgtcaggatg ggctatcttt gagccacgac      1560
     acccagcagt ggggggatgt cctgcctgat gggaatggaa cctaccagac ctgggtggcc      1620
     accaggattt gccgaggaga ggagcagagg ttcacctgct acatggaaca cagcgggaat      1680
     cacagcactc accctgtgcc ctctggtgag cctagggtga ccctggagag ggtcaggcca      1740
     gggtagggac agcagggatg gctgtggctc tctgcccagt gtataacaag tccctttttt      1800
     tcagggaaag tgctggtgct tcagagtcat tggcagacat tccatgtttc tgctgttgct      1860
     gctgctgctg ctatttttgt tattattatt ttctatgtcc gttgttgtaa gaagaaaaca      1920
     tcagctgcag agggtccagg tgagaannnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1980
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2040
     nnnnnnggag catttaccca tttccctctt ttctccagag ctcgtgagcc tgcaggtcct      2100
     ggatcaacac ccagttggga cgagtgacca cagggatgcc acacagctcg gatttcagcc      2160
     tctgatgtca gctcttgggt ccactggctc cactgagggc gcctagactc tacagccagg      2220
     cggctggaat tgaattccct gcctggatct cacaagcact ttccctct                   2268
//


spacer
spacer