spacer

EBI Dbfetch

ID   AH010532; SV 2; linear; genomic DNA; STD; HUM; 2288 BP.
XX
AC   AH010532; AF336071-AF336072;
XX
DT   30-JUN-2011 (Rel. 109, Created)
DT   30-JUN-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I chain-related protein A (MICA) gene, MICA*010
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2288
RX   DOI; 10.1034/j.1399-0039.2001.057006520.x.
RX   PUBMED; 11556982.
RA   Obuchi N., Takahashi M., Nouchi T., Satoh M., Arimura T., Ueda K., Akai J.,
RA   Ota M., Naruse T., Inoko H., Numano F., Kimura A.;
RT   "Identification of MICA alleles with a long Leu-repeat in the transmembrane
RT   region and no cytoplasmic tail due to a frameshift-deletion in exon 4";
RL   Tissue Antigens 57(6):520-535(2001).
XX
RN   [2]
RP   1-2288
RA   Obuchi N., Kimura A.;
RT   ;
RL   Submitted (16-JAN-2001) to the INSDC.
RL   3rd Department of Internal Medicine, Tokyo and Medical and Dental
RL   University, 1-3-45 Yushima, Bunkyou-Ku, Tokyo 113-8519, Japan
XX
DR   Ensembl-Gn; ENSG00000183214; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235233; homo_sapiens.
DR   Ensembl-Tr; ENST00000400325; homo_sapiens.
DR   Ensembl-Tr; ENST00000418465; homo_sapiens.
DR   Ensembl-Tr; ENST00000547609; homo_sapiens.
DR   IMGT/LIGM; AH010532.
XX
CC   On or before Jun 29, 2011 this sequence version replaced
CC   gi:13310418, gi:13310419, gi:13310417.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2288
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="T7526"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2288
FT                   /gene="MICA"
FT                   /allele="MICA*010"
FT   mRNA            join(<37..291,566..853,1441..1719,1819..1953,2098..>2288)
FT                   /gene="MICA"
FT                   /allele="MICA*010"
FT                   /product="MHC class I chain-related protein A"
FT   CDS             join(<37..291,566..853,1441..1719,1819..1953,2098..2225)
FT                   /codon_start=3
FT                   /gene="MICA"
FT                   /allele="MICA*010"
FT                   /product="MHC class I chain-related protein A"
FT                   /note="similar to protein encoded by GenBank Accession
FT                   Number U56949"
FT                   /db_xref="GOA:Q29983"
FT                   /db_xref="HGNC:HGNC:7090"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1B3J"
FT                   /db_xref="PDB:1HYR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29983"
FT                   /protein_id="AAK18281.1"
FT                   /translation="PHSLPYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQ
FT                   GQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTR
FT                   SSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADC
FT                   LQELRRYLESSVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSL
FT                   SHDTQQWGDVLPDGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQS
FT                   HWQTFHVSAVAAAAAIFVIIIFYVRCCKKKTSAAEGPELVSLQVLDQHPVGTSDHRDAT
FT                   QLGFQPLMSALGSTGSTEGA"
FT   exon            37..291
FT                   /gene="MICA"
FT                   /allele="MICA*010"
FT                   /number=2
FT   exon            566..853
FT                   /gene="MICA"
FT                   /allele="MICA*010"
FT                   /number=3
FT   exon            1441..1719
FT                   /gene="MICA"
FT                   /allele="MICA*010"
FT                   /number=4
FT   exon            1819..1953
FT                   /gene="MICA"
FT                   /allele="MICA*010"
FT                   /number=5
FT   gap             1963..2062
FT                   /estimated_length=unknown
FT   exon            2098..>2288
FT                   /gene="MICA"
FT                   /allele="MICA*010"
FT                   /number=6
FT   3'UTR           2226..>2288
FT                   /gene="MICA"
FT                   /allele="MICA*010"
XX
SQ   Sequence 2288 BP; 493 A; 591 C; 641 G; 463 T; 100 other;
     aggaagaagt ttcacctgtg atttcctctt ccccagagcc ccacagtctt ccttataacc        60
     tcacggtgct gtcctgggat ggatctgtgc agtcagggtt tcttgctgag gtacatctgg       120
     atggtcagcc cttcctgcgc tatgacaggc agaaatgcag ggcaaagccc cagggacagt       180
     gggcagaaga tgtcctggga aataagacat gggacagaga gaccagggac ttgacaggga       240
     acggaaagga cctcaggatg accctggctc atatcaagga ccagaaagaa ggtgagagtc       300
     ggcaggggca agagtgactg gagaggcctt ttccagaaaa gttaggggca gagagcaggg       360
     acctgtctct tcccactgga tctggctcag gctgggggtg aggaatgggg gtcagtggaa       420
     ctcagcaggg aggtgagccg gcactcagcc cacacaggga ggcatggagg agggccaggg       480
     aggcgtaccc cctgggctga gttcctcact tgggtggaaa ggtgatgggt tcgggaatgg       540
     agaagtcact gctgggtggg ggcaggcttg cattccctcc aggagattag ggtctgtgag       600
     atccatgaag acaacagcac caggagctcc cagcatttct actacgatgg ggagctcttc       660
     ctctcccaaa acctggagac tgaggaatgg acagtgcccc agtcctccag agctcagacc       720
     ttggccatga acgtcaggaa tttcttgaag gaagatgcca tgaagaccaa gacacactat       780
     cacgctatgc atgcagactg cctgcaggaa ctacggcgat atctagaatc cagcgtagtc       840
     ctgaggagaa caggtaccga cgctggccag gggctctcct ctccctccaa ttctgctaga       900
     gttgcctcac ctcccagatg tgtccaggga aaccctccct gtgctatgga tgaaggcatt       960
     tcctgttggc acatcgtgtc ctgattttcc tctattgtta gagccactgg ataaagacag      1020
     tgggtcaggg actggaccat ccagtgttgt aatcagggca agtagaggac cctccgacag      1080
     aatcctgagc ctgtggtggg tgtcaggtag gagaggaagc cttcagggcc agggctgccc      1140
     cctctgcctc ccagcctgcc catcctggag agttccctcc tggccccaca acccaggagt      1200
     ccacccctga catccccctc ctcagcatca atgtggggat cccagagcct gaggccacag      1260
     tcccaaggcc catcctcctg ccagcctgga agaactgggc cccagagtga ggacagactt      1320
     gcaggtcagg ggtcccggag ggcttcagcc agagtgagaa cagtgaagag aaacagccct      1380
     gttcctctcc cctccttaga ggggagcagg gcttcactgg ctctgccctt tcttctccag      1440
     tgccccccat ggtgaatgtc acccgcagcg aggcctcaga gggcaacatc accgtgacat      1500
     gcagggcttc cagcttctat ccccggaata tcatactgac ctggcgtcag gatggggtat      1560
     ctttgagcca cgacacccag cagtgggggg atgtcctgcc tgatgggaat ggaacctacc      1620
     agacctgggt ggccaccagg atttgccgag gagaggagca gaggttcacc tgctacatgg      1680
     aacacagcgg gaatcacagc actcaccctg tgccctctgg tgagcctagg gtgaccctgg      1740
     agagggtcag gccagggtag ggacagcagg gatggctgtg gctctctgcc cagtgtataa      1800
     caagtccctt tttttcaggg aaagtgctgg tgcttcagag tcattggcag acattccatg      1860
     tttctgctgt tgctgctgct gctgctattt ttgttattat tattttctat gtccgttgtt      1920
     gtaagaagaa aacatcagct gcagagggtc caggtgagaa aannnnnnnn nnnnnnnnnn      1980
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2040
     nnnnnnnnnn nnnnnnnnnn nnagtggagc atttacccat ttccctcttt tctccagagc      2100
     tcgtgagcct gcaggtcctg gatcaacacc cagttgggac gagtgaccac agggatgcca      2160
     cacagctcgg atttcagcct ctgatgtcag ctcttgggtc cactggctcc actgagggcg      2220
     cctagactct acagccaggc ggctggaatt gaattccctg cctggatctc acaagcactt      2280
     tccctctt                                                               2288
//


spacer
spacer