spacer

EBI Dbfetch

ID   AH010569; SV 2; linear; genomic DNA; STD; HUM; 2296 BP.
XX
AC   AH010569; AF336069-AF336070;
XX
DT   30-JUN-2011 (Rel. 109, Created)
DT   30-JUN-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I chain-related protein A (MICA) gene, MICA*009
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2296
RX   DOI; 10.1034/j.1399-0039.2001.057006520.x.
RX   PUBMED; 11556982.
RA   Obuchi N., Takahashi M., Nouchi T., Satoh M., Arimura T., Ueda K., Akai J.,
RA   Ota M., Naruse T., Inoko H., Numano F., Kimura A.;
RT   "Identification of MICA alleles with a long Leu-repeat in the transmembrane
RT   region and no cytoplasmic tail due to a frameshift-deletion in exon 4";
RL   Tissue Antigens 57(6):520-535(2001).
XX
RN   [2]
RP   1-2296
RA   Obuchi N., Kimura A.;
RT   ;
RL   Submitted (16-JAN-2001) to the INSDC.
RL   3rd Department of Internal Medicine, Tokyo and Medical and Dental
RL   University, 1-3-45 Yushima, Bunkyou-Ku, Tokyo 113-8519, Japan
XX
DR   Ensembl-Gn; ENSG00000183214; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235233; homo_sapiens.
DR   Ensembl-Tr; ENST00000400325; homo_sapiens.
DR   Ensembl-Tr; ENST00000418465; homo_sapiens.
DR   Ensembl-Tr; ENST00000547609; homo_sapiens.
DR   IMGT/LIGM; AH010569.
XX
CC   On or before Jun 29, 2011 this sequence version replaced
CC   gi:13430212, gi:13430213, gi:13430211.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2296
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="E4181324"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2296
FT                   /gene="MICA"
FT                   /allele="MICA*009"
FT   mRNA            join(<25..279,554..841,1429..1707,1807..1944,2107..>2296)
FT                   /gene="MICA"
FT                   /allele="MICA*009"
FT                   /product="MHC class I chain-related protein A"
FT   CDS             join(<25..279,554..841,1429..1707,1807..1944,2107..2234)
FT                   /codon_start=3
FT                   /gene="MICA"
FT                   /allele="MICA*009"
FT                   /product="MHC class I chain-related protein A"
FT                   /note="similar to protein encoded by GenBank Accession
FT                   Number U56948"
FT                   /db_xref="GOA:Q29983"
FT                   /db_xref="HGNC:HGNC:7090"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1B3J"
FT                   /db_xref="PDB:1HYR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29983"
FT                   /protein_id="AAK25771.1"
FT                   /translation="PHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQ
FT                   GQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTR
FT                   SSQHFYYDGELFLSQNVETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADC
FT                   LQELRRYLESSVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNITLTWRQDGVSL
FT                   SHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQS
FT                   HWQTFHVSAVAAAAAAIFVIIIFYVRCCKKKTSAAEGPELVSLQVLDQHPVGTSDHRDA
FT                   TQLGFQPLMSALGSTGSTEGA"
FT   exon            25..279
FT                   /gene="MICA"
FT                   /allele="MICA*009"
FT                   /number=2
FT   exon            554..841
FT                   /gene="MICA"
FT                   /allele="MICA*009"
FT                   /number=3
FT   exon            1429..1707
FT                   /gene="MICA"
FT                   /allele="MICA*009"
FT                   /number=4
FT   exon            1807..1944
FT                   /gene="MICA"
FT                   /allele="MICA*009"
FT                   /number=5
FT   gap             1972..2071
FT                   /estimated_length=unknown
FT   exon            2107..>2296
FT                   /gene="MICA"
FT                   /allele="MICA*009"
FT                   /number=6
FT   3'UTR           2235..>2296
FT                   /gene="MICA"
FT                   /allele="MICA*009"
XX
SQ   Sequence 2296 BP; 492 A; 592 C; 649 G; 463 T; 100 other;
     cacctgtgat ttcctcttcc ccagagcccc acagtcttcg ttataacctc acggtgctgt        60
     cctgggatgg atctgtgcag tcagggtttc ttgctgaggt acatctggat ggtcagccct       120
     tcctgcgcta tgacaggcag aaatgcaggg caaagcccca gggacagtgg gcagaagatg       180
     tcctgggaaa taagacatgg gacagagaga ccagggactt gacagggaac ggaaaggacc       240
     tcaggatgac cctggctcat atcaaggacc agaaagaagg tgagagtcgg caggggcaag       300
     agtgactgga gaggcctttt ccagaaaagt taggggcaga gagcagggac ctgtctcttc       360
     ccactggatc tggctcaggc tgggggtgag gaatgggggt cagtggaact cagcagggag       420
     gtgagccggc actcagccca cacagggagg catgggggag ggccagggag gcgtacctcc       480
     tgggctgagt tcctcacttg ggtggaaagg tgatgggttc gggaatggag aagtcactgc       540
     tgggtggggg caggcttgca ttccctccag gagattaggg tctgtgagat ccatgaagac       600
     aacagcacca ggagctccca gcatttctac tacgatgggg agctcttcct ctcccaaaac       660
     gtggagactg aggaatggac agtgccccag tcctccagag ctcagacctt ggccatgaac       720
     gtcaggaatt tcttgaagga agatgccatg aagaccaaga cacactatca cgctatgcat       780
     gcagactgcc tgcaggaact acggcgatat ctagaatcca gcgtagtcct gaggagaaca       840
     ggtacggacg ctggccaggg gctctcctct ccctccaatt ctgctagagt tgcctcacct       900
     ccaagatgtg tccagggaaa ccctccctgt gctatggatg aaggcatttc ctgttggcac       960
     atcgtgtcct gattttcctc tattgttaga gccactggat aaagacagtg ggtcagggac      1020
     tggaccatcc agtgttgtaa tcagggcaag tagaggaccc tccgacagaa tcctgagcct      1080
     gtggtgggtg tcaggcagga gaggaagcct tcagggccag ggctgccccc tctgcctccc      1140
     agcctgccca tcctggagag ttccctcctg gccccacaac ccaggagtcc acccctgaca      1200
     tccccctcct cagcatcaat gtggggatcc cagagcctga ggccacagtc ccaaggccca      1260
     tcctcctgcc agcctggaag aactgggccc cagagtgagg acagacttgc aggtcagggg      1320
     tcccggaggg cttcagccag agtgagaaca gtgaagagaa acagccctgt tcctctcccc      1380
     tccttagagg ggagcagggc ttcactggct ctgccctttc ttctccagtg ccccccatgg      1440
     tgaatgtcac ccgcagcgag gcctcagagg gcaacatcac cgtgacatgc agggcttcca      1500
     gcttctatcc ccggaatatc acactgacct ggcgtcagga tggggtatct ttgagccacg      1560
     acacccagca gtggggggat gtcctgcctg atgggaatgg aacctaccag acctgggtgg      1620
     ccaccaggat ttgccaagga gaggagcaga ggttcacctg ctacatggaa cacagcggga      1680
     atcacagcac tcaccctgtg ccctctggtg agcctagggt gaccctggag agggtcaggc      1740
     cagggtaggg acagcaggga tggctgtggc tctctgccca gtgtataaca agtccctttt      1800
     tttcagggaa agtgctggtg cttcagagtc attggcagac attccatgtt tctgctgttg      1860
     ctgctgctgc tgctgctatt tttgttatta ttattttcta tgtccgttgt tgtaagaaga      1920
     aaacatcagc tgcagagggt ccaggtgaga aaagcgggca gtttctggag annnnnnnnn      1980
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2040
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nagtggagca tttacccatt tccctctttt      2100
     ctccagagct cgtgagcctg caggtcctgg atcaacaccc agttgggacg agtgaccaca      2160
     gggatgccac acagctcgga tttcagcctc tgatgtcagc tcttgggtcc actggctcca      2220
     ctgagggcgc ctagactcta cagccaggcg gctggaattg aattccctgc ctggatctca      2280
     caagcacttt ccctct                                                      2296
//


spacer
spacer