Dbfetch

ID   AH010568; SV 2; linear; genomic DNA; STD; HUM; 2285 BP.
XX
AC   AH010568; AF336067-AF336068;
XX
DT   30-JUN-2011 (Rel. 109, Created)
DT   30-JUN-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I chain-related protein A (MICA) gene, MICA*008
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2285
RX   DOI; 10.1034/j.1399-0039.2001.057006520.x.
RX   PUBMED; 11556982.
RA   Obuchi N., Takahashi M., Nouchi T., Satoh M., Arimura T., Ueda K., Akai J.,
RA   Ota M., Naruse T., Inoko H., Numano F., Kimura A.;
RT   "Identification of MICA alleles with a long Leu-repeat in the transmembrane
RT   region and no cytoplasmic tail due to a frameshift-deletion in exon 4";
RL   Tissue Antigens 57(6):520-535(2001).
XX
RN   [2]
RP   1-2285
RA   Obuchi N., Kimura A.;
RT   ;
RL   Submitted (16-JAN-2001) to the INSDC.
RL   3rd Department of Internal Medicine, Tokyo and Medical and Dental
RL   University, 1-3-45 Yushima, Bunkyou-Ku, Tokyo 113-8519, Japan
XX
DR   MD5; 9438aba60d2dea1d024bcb7444dd37de.
DR   Ensembl-Gn; ENSG00000183214; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235233; homo_sapiens.
DR   Ensembl-Tr; ENST00000400325; homo_sapiens.
DR   Ensembl-Tr; ENST00000418465; homo_sapiens.
DR   Ensembl-Tr; ENST00000547609; homo_sapiens.
DR   IMGT/LIGM; AH010568.
XX
CC   On or before Jun 29, 2011 this sequence version replaced
CC   gi:13430208, gi:13430209, gi:13430207.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2285
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="MADURA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2285
FT                   /gene="MICA"
FT                   /allele="MICA*008"
FT   mRNA            join(<33..287,562..849,1437..1715,1815..1950,2095..>2285)
FT                   /gene="MICA"
FT                   /allele="MICA*008"
FT                   /product="MHC class I chain-related protein A"
FT   CDS             join(<33..287,562..849,1437..1715,1815..1921)
FT                   /codon_start=3
FT                   /gene="MICA"
FT                   /allele="MICA*008"
FT                   /product="MHC class I chain-related protein A"
FT                   /note="premature stop compared to sequence encoded by other
FT                   alleles"
FT                   /db_xref="GOA:Q29983"
FT                   /db_xref="HGNC:HGNC:7090"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1B3J"
FT                   /db_xref="PDB:1HYR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29983"
FT                   /protein_id="AAK25770.1"
FT                   /translation="PHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQ
FT                   GQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTR
FT                   SSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADC
FT                   LQELRRYLESGVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSL
FT                   SHDTQQWGDVLPDGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQS
FT                   HWQTFHVSAVAAGCCYFCYYYFLCPLL"
FT   exon            33..287
FT                   /gene="MICA"
FT                   /allele="MICA*008"
FT                   /number=2
FT   exon            562..849
FT                   /gene="MICA"
FT                   /allele="MICA*008"
FT                   /number=3
FT   exon            1437..1715
FT                   /gene="MICA"
FT                   /allele="MICA*008"
FT                   /number=4
FT   exon            1815..1950
FT                   /gene="MICA"
FT                   /allele="MICA*008"
FT                   /number=5
FT   3'UTR           join(1922..1950,2095..>2285)
FT                   /gene="MICA"
FT                   /allele="MICA*008"
FT   gap             1960..2059
FT                   /estimated_length=unknown
FT   exon            2095..>2285
FT                   /gene="MICA"
FT                   /allele="MICA*008"
FT                   /number=6
XX
SQ   Sequence 2285 BP; 493 A; 591 C; 640 G; 461 T; 100 other;
     agaagtttca cctgtgattt cctcttcccc agagccccac agtcttcgtt ataacctcac        60
     ggtgctgtcc tgggatggat ctgtgcagtc agggtttctt gctgaggtac atctggatgg       120
     tcagcccttc ctgcgctatg acaggcagaa atgcagggca aagccccagg gacagtgggc       180
     agaagatgtc ctgggaaata agacatggga cagagagacc agggacttga cagggaacgg       240
     aaaggacctc aggatgaccc tggctcatat caaggaccag aaagaaggtg agagtcggca       300
     ggggcaagag tgactggaga ggccttttcc agaaaagtta ggggcagaga gcagggacct       360
     gtctcttccc actggatctg gctcaggctg ggggtgagga atgggggtca gtggaactca       420
     gcagggaggt gagccggcac tcagcccaca cagggaggca tggaggaggg ccagggaggc       480
     ataccccctg ggctgagttc ctcacttggg tggaaaggtg atgggttcgg gaatggagaa       540
     gtcactgctg ggtgggggca ggcttgcatt ccctccagga gattagggtc tgtgagatcc       600
     atgaagacaa cagcaccagg agctcccagc atttctacta cgatggggag ctcttcctct       660
     cccaaaacct ggagactgag gaatggacag tgccccagtc ctccagagct cagaccttgg       720
     ccatgaacgt caggaatttc ttgaaggaag atgccatgaa gaccaagaca cactatcacg       780
     ctatgcatgc agactgcctg caggaactac ggcgatatct agaatccggc gtagtcctga       840
     ggagaacagg taccgacgct ggccaggggc tctcctctcc ctccaattct gctagagttg       900
     cctcacctcc cagatgtgtc cagggaaacc ctccctgtgc tatggatgaa ggcatttcct       960
     gttggcacat cgtgtcctga ttttcctcta ttgttagagc cactggataa agacagaggg      1020
     tcagggactg gaccatccag tgttgtaatc agggcaagta gaggaccctc cgacagaatc      1080
     ctgagcctgt ggtgggtgtc aggcaggaga ggaagccttc agggccaggg ctgccccctc      1140
     tgcctcccag cctgcccatc ctggagagtt ccctcctggc cccacaaccc aggagtccac      1200
     ccctgacatc cccctcctca gcatcaatgt ggggatccca gagcctgagg ccacagtccc      1260
     aaggcccatc ctcctgccag cctggaagaa ctgggcccca gagtgaggac agacttgcag      1320
     gtcaggggtc ccggagggct tcagccagag tgagaacagt gaagagaaac agccctgttc      1380
     ctctcccctc cttagagggg agcagggctt cactggctct gccctttctt ctccagtgcc      1440
     ccccatggtg aatgtcaccc gcagcgaggc ctcagagggc aacatcaccg tgacatgcag      1500
     ggcttccagc ttctatcccc ggaatatcat actgacctgg cgtcaggatg gggtatcttt      1560
     gagccacgac acccagcagt ggggggatgt cctgcctgat gggaatggaa cctaccagac      1620
     ctgggtggcc accaggattt gccgaggaga ggagcagagg ttcacctgct acatggaaca      1680
     cagcgggaat cacagcactc accctgtgcc ctctggtgag cctagggtga ccctggagag      1740
     ggtcaggcca gggtagggac agcagggatg gctgtggctc tctgcccagt gtataacaag      1800
     tccctttttt tcagggaaag tgctggtgct tcagagtcat tggcagacat tccatgtttc      1860
     tgctgttgct gctggctgct gctatttttg ttattattat tttctatgtc cgttgttgta      1920
     agaagaaaac atcagctgca gagggtccag gtgagaaaan nnnnnnnnnn nnnnnnnnnn      1980
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2040
     nnnnnnnnnn nnnnnnnnna gtggagcatt tacccatttc cctcttttct ccagagctcg      2100
     tgagcctgca ggtcctggat caacacccag ttgggacgag tgaccacagg gatgccacac      2160
     agctcggatt tcagcctctg atgtcagctc ttgggtccac tggctccact gagggcacct      2220
     agactctaca gccaggcggc tggaattgaa ttccctgcct ggatctcaca agcactttcc      2280
     ctctt                                                                  2285
//