Dbfetch

ID   AH010526; SV 2; linear; genomic DNA; STD; HUM; 2237 BP.
XX
AC   AH010526; AF336065-AF336066;
XX
DT   30-JUN-2011 (Rel. 109, Created)
DT   30-JUN-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I chain-related protein A (MICA) gene, MICA*006
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2237
RX   DOI; 10.1034/j.1399-0039.2001.057006520.x.
RX   PUBMED; 11556982.
RA   Obuchi N., Takahashi M., Nouchi T., Satoh M., Arimura T., Ueda K., Akai J.,
RA   Ota M., Naruse T., Inoko H., Numano F., Kimura A.;
RT   "Identification of MICA alleles with a long Leu-repeat in the transmembrane
RT   region and no cytoplasmic tail due to a frameshift-deletion in exon 4";
RL   Tissue Antigens 57(6):520-535(2001).
XX
RN   [2]
RP   1-2237
RA   Obuchi N., Kimura A.;
RT   ;
RL   Submitted (16-JAN-2001) to the INSDC.
RL   3rd Department of Internal Medicine, Tokyo and Medical and Dental
RL   University, 1-3-45 Yushima, Bunkyou-Ku, Tokyo 113-8519, Japan
XX
DR   MD5; 6e84b47c8ab3766e5e93f8dcbeb17337.
DR   Ensembl-Gn; ENSG00000183214; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235233; homo_sapiens.
DR   Ensembl-Tr; ENST00000400325; homo_sapiens.
DR   Ensembl-Tr; ENST00000418465; homo_sapiens.
DR   Ensembl-Tr; ENST00000547609; homo_sapiens.
DR   IMGT/LIGM; AH010526.
XX
CC   On or before Jun 29, 2011 this sequence version replaced
CC   gi:13274607, gi:13274608, gi:13274606.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2237
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="KAS116"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2237
FT                   /gene="MICA"
FT                   /allele="MICA*006"
FT   mRNA            join(<1..255,530..817,1405..1683,1783..1920,2063..>2237)
FT                   /gene="MICA"
FT                   /allele="MICA*006"
FT                   /product="MHC class I chain-related protein A"
FT   CDS             join(<1..255,530..817,1405..1683,1783..1920,2063..2190)
FT                   /codon_start=3
FT                   /gene="MICA"
FT                   /allele="MICA*006"
FT                   /product="MHC class I chain-related protein A"
FT                   /note="similar to protein encoded by GenBank Accession
FT                   Number U56945"
FT                   /db_xref="GOA:Q29983"
FT                   /db_xref="HGNC:HGNC:7090"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1B3J"
FT                   /db_xref="PDB:1HYR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29983"
FT                   /protein_id="AAK17997.1"
FT                   /translation="PHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQ
FT                   GQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTR
FT                   SSQHFYYDGELFLSQNVETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADC
FT                   LQELRRYLESSIVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNITLTWRQDGVSL
FT                   SHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQS
FT                   HWQTFHVSAVAAAAAAIFVIIIFYVRCCKKKTSAAEGPELVSLQVLDQHPVGTSDHRDA
FT                   TQLGFQPLMSALGSTGSTEGA"
FT   exon            1..255
FT                   /gene="MICA"
FT                   /allele="MICA*006"
FT                   /number=2
FT   exon            530..817
FT                   /gene="MICA"
FT                   /allele="MICA*006"
FT                   /number=3
FT   exon            1405..1683
FT                   /gene="MICA"
FT                   /allele="MICA*006"
FT                   /number=4
FT   exon            1783..1920
FT                   /gene="MICA"
FT                   /allele="MICA*006"
FT                   /number=5
FT   gap             1928..2027
FT                   /estimated_length=unknown
FT   exon            2063..>2237
FT                   /gene="MICA"
FT                   /allele="MICA*006"
FT                   /number=6
FT   3'UTR           2191..>2237
FT                   /gene="MICA"
FT                   /allele="MICA*006"
XX
SQ   Sequence 2237 BP; 482 A; 574 C; 636 G; 445 T; 100 other;
     agccccacag tcttcgttat aacctcacgg tgctgtcctg ggatggatct gtgcagtcag        60
     ggtttcttgc tgaggtacat ctggatggtc agcccttcct gcgctatgac aggcagaaat       120
     gcagggcaaa gccccaggga cagtgggcag aagatgtcct gggaaataag acatgggaca       180
     gagagaccag ggacttgaca gggaacggaa aggacctcag gatgaccctg gctcatatca       240
     aggaccagaa agaaggtgag agtcggcagg ggcaagagtg actggagagg ccttttccag       300
     aaaagttagg ggcagagagc agggacctgt ctcttcccac tggatctggc tcaggctggg       360
     ggtgaggaat gggggtcagt ggaactcagc agggaggtga gccggcactc agcccacaca       420
     gggaggcatg ggggagggcc agggaggcgt accccctggg ctgagttcct cacttgggtg       480
     gaaaggtgat gggttcggga atggagaagt cactgctggg tgggggcagg cttgcattcc       540
     ctccaggaga ttagggtctg tgagatccat gaagacaaca gcaccaggag ctcccagcat       600
     ttctactacg atggggagct cttcctctcc caaaacgtgg agactgagga atggacagtg       660
     ccccagtcct ccagagctca gaccttggcc atgaacgtca ggaatttctt gaaggaagat       720
     gccatgaaga ccaagacaca ctatcacgct atgcatgcag actgcctgca ggaactacgg       780
     cgatatctag aatccagcat agtcctgagg agaacaggta cggacgctgg ccaggggctc       840
     tcctctccct ccaattctgc tagagttgcc tcacctccaa gatgtgtcca gggaaaccct       900
     ccctgtgcta tggatgaagg catttcctgt tggcacatcg tgtcctgatt ttcctctatt       960
     gttagagcca ctggataaag acagtgggtc agggactgga ccatccagtg ttgtaatcag      1020
     ggcaagtaga ggaccctccg acagaatcct gagcctgtgg tgggtgtcag gcaggagagg      1080
     aagccttcag ggccagggct gccccctctg cctcccagcc tgcccatcct ggagagttcc      1140
     ctcctggccc cacaacccag gagtccaccc ctgacatccc cctcctcagc atcaatgtgg      1200
     ggatcccaga gcctgaggcc acagtcccaa ggcccatcct cctgccagcc tggaagaact      1260
     gggccccaga gtgaggacag acttgcaggt caggggtccc ggagggcttc agccagagtg      1320
     agaacagtga agagaaacag ccctgttcct ctcccctcct tagaggggag cagggcttca      1380
     ctggctctgc cctttcttct ccagtgcccc ccatggtgaa tgtcacccgc agcgaggcct      1440
     cagagggcaa catcaccgtg acatgcaggg cttccagctt ctatccccgg aatatcacac      1500
     tgacctggcg tcaggatggg gtatctttga gccacgacac ccagcagtgg ggggatgtcc      1560
     tgcctgatgg gaatggaacc taccagacct gggtggccac caggatttgc caaggagagg      1620
     agcagaggtt cacctgctac atggaacaca gcgggaatca cagcactcac cctgtgccct      1680
     ctggtgagcc tagggtgacc ctggagaggg tcaggccagg gtagggacag cagggatggc      1740
     tgtggctctc tgcccagtgt ataacaagtc cctttttttc agggaaagtg ctggtgcttc      1800
     agagtcattg gcagacattc catgtttctg ctgttgctgc tgctgctgct gctatttttg      1860
     ttattattat tttctatgtc cgttgttgta agaagaaaac atcagctgca gagggtccag      1920
     gtgagaannn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1980
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnagt ggagcattta      2040
     cccatttccc tcttttctcc agagctcgtg agcctgcagg tcctggatca acacccagtt      2100
     gggacgagtg accacaggga tgccacacag ctcggatttc agcctctgat gtcagctctt      2160
     gggtccactg gctccactga gggcgcctag actctacagc caggcggctg gaattgaatt      2220
     ccctgcctgg atctcac                                                     2237
//