spacer

EBI Dbfetch

ID   AF335547; SV 1; linear; genomic DNA; STD; HUM; 955 BP.
XX
AC   AF335547;
XX
DT   02-JUL-2001 (Rel. 68, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*1567 allele, exons 2
DE   and 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-955
RA   Luo M., Embree J., Ramdahin S., Ndinya-Achola J., Njenga S., Bwayo J.,
RA   Pan S., Mao X., Stuart T., Brunham R., Plummer F.;
RT   "HLA-A and HLA-B alleles in Kenya, Africa: allele frequencies and
RT   identification of novel alleles B*1567 and B*4426";
RL   Tissue Antigens 0:0-0(2001).
XX
RN   [2]
RP   1-955
RA   Luo M., Embree J., Ramdahin S., Pan S., Mao X., Brunham R., Plummer F.;
RT   ;
RL   Submitted (11-JAN-2001) to the INSDC.
RL   Medical Microbiology, University of Manitoba, 730 William Avenue, Winnipeg,
RL   Manitoba R3E 0W3, Canada
XX
DR   MD5; fe993e6fdf6446dd06ca4f1db7977d65.
DR   EuropePMC; PMC150628; 12634388.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..955
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            101..370
FT                   /gene="HLA-B"
FT                   /number=2
FT   mRNA            join(<101..370,621..>896)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT   CDS             join(<101..370,621..>896)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /note="part of the peptide binding domain"
FT                   /db_xref="GOA:Q95IG9"
FT                   /db_xref="IMGT/HLA:B*15:67"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q95IG9"
FT                   /protein_id="AAK69632.1"
FT                   /translation="SHFMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMA
FT                   PRAPWIEQEGPEYWDRETRNMKASAQTYRENLRIALRYYNQSEAGSHTWQRMYGCDLGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQHKWEAAREAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            621..896
FT                   /gene="HLA-B"
FT                   /number=3
XX
SQ   Sequence 955 BP; 159 A; 315 C; 357 G; 124 T; 0 other;
     gcccttggga ggagcgaggg gaccgcaggc gggggcgcag gacccgggga gccgcgccgg        60
     gaggagggtc gggcgggtct cagcccctcc tcgcccccag gctcccactt catgaggtat       120
     ttctacaccg ccatgtcccg gcccggccgc ggggagcccc gcttcatcgc agtgggctac       180
     gtggacgaca cgcagttcgt gaggttcgac agcgacgccg cgagtccgag gatggcgccc       240
     cgggcgccat ggatagagca ggaggggccg gagtattggg accgggagac acggaacatg       300
     aaggcctccg cgcagactta ccgagagaac ctgcggatcg cgctccgcta ctacaaccag       360
     agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca cgactcccca tcccccacgt       420
     acggcccggg tcgccccgag tctccgggtc cgagatccgc ccccctgagg ccgcgggacc       480
     cgcccaaacc ctcgaccggc gagagcccca ggcgcgttta cccggtttca ttttcagttg       540
     aggccaaaat ccccgcgggt tggtcggggc ggggcggggc ggggctcggg ggacggggct       600
     gaccgcgggg cctgggccag ggtctcacac ttggcagagg atgtatggct gcgacctggg       660
     gccggacggg cgcctcctcc gcgggcatga ccagtccgcc tacgacggca aggattacat       720
     cgccctgaac gaggacctga gctcctggac cgcggcggac acggcggctc agatcaccca       780
     gcacaagtgg gaggcggccc gtgaggcgga gcagctgaga gcctacctgg agggcctgtg       840
     cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgggtac       900
     caggggcagt ggggagcctt ccccatctcc tataggtcgc cggggatggc ctcca            955
//


spacer
spacer