spacer

EBI Dbfetch

ID   AF335318; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AF335318;
XX
DT   13-FEB-2001 (Rel. 66, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*03052 allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1034/j.1399-0039.2002.590217.x.
RX   PUBMED; 12028548.
RA   Greville W.D., Chapman G., Hogbin J.-P., Kennedy A., Dunckley H.;
RT   "Novel HLA-DRB1 alleles discovered during routine sequencing based typing,
RT   DRB1*03052, DRB1*04032, DRB1*1139 and DRB1*1346";
RL   Tissue Antigens 59(2):154-156(2002).
XX
RN   [2]
RP   1-270
RA   Greville W.D., Chapman G., Hogbin J.;
RT   ;
RL   Submitted (10-JAN-2001) to the INSDC.
RL   Molecular Genetics Laboratory, Tissue Typing Services, Australian Red Cross
RL   Blood Service, 153 Clarence Street, Sydney, NSW 2000, Australia
XX
DR   MD5; 4ff9deb8cdf61535ec297797215ac0a1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q9BD27"
FT                   /db_xref="IMGT/HLA:DRB1*03:05:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9BD27"
FT                   /protein_id="AAK07657.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /number=2
XX
SQ   Sequence 270 BP; 58 A; 64 C; 99 G; 49 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggtacctgga cagatacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagaag cggggccggg tggacaacta ctgcagacac aactacgggg       240
     ttggtgagag cttcacggtg cagcggcgag                                        270
//


spacer
spacer