spacer

EBI Dbfetch

ID   AF332021; SV 1; linear; genomic DNA; STD; ROD; 898 BP.
XX
AC   AF332021;
XX
DT   12-JUL-2001 (Rel. 68, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 3)
XX
DE   Meriones shawi growth hormone receptor (GHR) gene, partial cds.
XX
KW   .
XX
OS   Meriones shawi (Shaw's jird)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Gerbillinae; Meriones.
XX
RN   [1]
RP   1-898
RX   PUBMED; 11319262.
RA   Adkins R.M., Gelke E.L., Rowe D., Honeycutt R.L.;
RT   "Molecular phylogeny and divergence time estimates for major rodent groups:
RT   evidence from multiple genes";
RL   Mol. Biol. Evol. 18(5):777-791(2001).
XX
RN   [2]
RP   1-898
RA   Adkins R.M., Gelke E.L., Rowe D., Honeycutt R.L.;
RT   ;
RL   Submitted (26-DEC-2000) to the INSDC.
RL   Biology, University of Massachusetts, 221 Morrill Science Center, Amherst,
RL   MA 01003, USA
XX
DR   MD5; a90235ff8e743c92dcde6acd00487a03.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..898
FT                   /organism="Meriones shawi"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:37435"
FT   gene            <1..>898
FT                   /gene="GHR"
FT   mRNA            <1..>898
FT                   /gene="GHR"
FT                   /product="growth hormone receptor"
FT   CDS             <1..>898
FT                   /codon_start=2
FT                   /gene="GHR"
FT                   /product="growth hormone receptor"
FT                   /db_xref="InterPro:IPR025871"
FT                   /db_xref="UniProtKB/TrEMBL:Q924G6"
FT                   /protein_id="AAK71897.1"
FT                   /translation="GIHDNYKPDFYNDDSWVEFIELDIDDPDEKTEGSDTDRLLSKDHE
FT                   KSVSILGAKDDDSGRTSCYDPEILDTDFHTSDVGDGTSQSQKLRAEADLLCLDQKNLKN
FT                   SPYDASLGSLHPCITPAVEEDKPQALVSSETESTHQLASTLMSNPSSLANIDFYAQVSD
FT                   ITPAGSVVLSPGQKIKAGIAQCNTQPEAAAPCQENYGMNSAYFCESDAKKCIAVAPHME
FT                   ARSCAKPDFNQEDIYITTESLTTTARMSKTTELAPDAEVPVPDYTAVHTVQSPRGLILN
FT                   ATALPLPDKKKFLSSCGY"
FT   exon            <1..>898
FT                   /gene="GHR"
FT                   /number=10
XX
SQ   Sequence 898 BP; 261 A; 235 C; 198 G; 204 T; 0 other;
     aggcattcat gataactaca aacctgactt ctacaatgat gactcctggg ttgagtttat        60
     tgagttagat attgatgacc cagatgaaaa gactgaaggg tcagacacag acagacttct       120
     aagcaaagac catgagaaat cagttagtat ccttggagca aaagatgatg attctggacg       180
     taccagctgt tatgatcctg aaattttgga cactgatttc cacaccagtg acgtgggtga       240
     tggtacctca cagtcacaga agttaagagc ggaagccgat ctcttgtgcc ttgaccagaa       300
     gaatctaaaa aactcacctt atgatgcttc ccttggctct ctgcacccgt gcattactcc       360
     agcagtggaa gaagacaaac cacaggcact cgtgagcagt gaaactgaat caacccacca       420
     actggcctct acactgatga gcaatccctc ttcacttgct aacattgact tttatgccca       480
     agtaagcgat attacaccag caggcagtgt agtcctttcc ccaggtcaaa agattaaggc       540
     aggaatagcc cagtgcaaca cgcagccaga ggcggccgca ccctgccaag aaaattacgg       600
     catgaatagt gcctacttct gtgagtcaga tgccaaaaag tgcatcgctg tggcccctca       660
     catggaggcc aggtcatgtg caaaaccaga ctttaaccag gaggacattt atatcaccac       720
     agaaagcctt accactactg cacggatgtc caagacaaca gagcttgctc cagatgctga       780
     ggtgcctgtc ccagactaca ccgcggttca caccgtgcag tcgccacggg gccttatact       840
     caacgcgact gctttgcctt tgcctgacaa aaagaagttc ctctcctcct gtggctat         898
//


spacer
spacer