spacer

EBI Dbfetch

ID   AF329281; SV 1; linear; genomic DNA; STD; HUM; 268 BP.
XX
AC   AF329281;
XX
DT   21-MAR-2001 (Rel. 67, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*11011 variant
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-268
RA   Hurley C.K., Tang T.F., Yao H.;
RT   "Human Leukocyte Antigen Class II DRB1*110111 variant";
RL   Unpublished.
XX
RN   [2]
RP   1-268
RA   Hurley C.K., Tang T.F., Yao H.;
RT   ;
RL   Submitted (14-DEC-2000) to the INSDC.
RL   Microbiology and Immunology, Georgetown University, 3970 Reservoir Rd. NW,
RL   Washington, DC 20007, USA
XX
DR   MD5; 3e0cb3fb3d0c7180530b83293eed63f2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..268
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="NT0015"
FT                   /tissue_type="whole blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>268
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   exon            1..268
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   CDS             <1..>268
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q9BCT6"
FT                   /db_xref="IMGT/HLA:DRB1*11:01:04"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9BCT6"
FT                   /protein_id="AAK21117.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAV
FT                   TELGRPDEEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQRR"
XX
SQ   Sequence 268 BP; 57 A; 62 C; 97 G; 52 T; 0 other;
     cgtttcttgg agtactctac gtctgagtgt catttcttca acgggacgga gcgggtgcgg        60
     ttcctggaca gatacttcta taaccaagag gagtacgtgc gcttcgacag cgacgtgggg       120
     gagttccggg cggtgacgga gctggggcgg cctgatgagg agtactggaa cagccagaag       180
     gacttcctgg aagacaggcg ggccgcggtg gacacctact gcagacacaa ctacggggtt       240
     ggtgagagct tcacagtgca gcggcgag                                          268
//


spacer
spacer