spacer

EBI Dbfetch

ID   AF327743; SV 1; linear; genomic DNA; STD; HUM; 258 BP.
XX
AC   AF327743;
XX
DT   15-FEB-2001 (Rel. 66, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-258
RA   Hurley C., Tang T., Li L.;
RT   "Human Leokocyte Antigen Class II DRB1*0802 Variant";
RL   Unpublished.
XX
RN   [2]
RP   1-258
RA   Hurley C., Tang T., Li L.;
RT   ;
RL   Submitted (11-DEC-2000) to the INSDC.
RL   Microbiology & Immunology, Georgetown University, 3970 Reservoir Rd.,
RL   Washington D.C. 20057, USA
XX
DR   MD5; 786f8e841327a146562110203d1e1976.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..258
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            <1..>258
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   mRNA            <1..>258
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>258
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q9BD34"
FT                   /db_xref="IMGT/HLA:DRB1*08:02:03"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9BD34"
FT                   /protein_id="AAK08493.1"
FT                   /translation="RFLEYSTGECYFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDFLEDRRALVDTYCRHNYGVGESFTV"
XX
SQ   Sequence 258 BP; 55 A; 58 C; 92 G; 53 T; 0 other;
     cgtttcttgg agtactctac gggtgagtgt tatttcttca atgggacgga gcgggtgcgg        60
     ttcctggaca gatacttcta taaccaagag gagtacgtgc gcttcgacag cgacgtgggg       120
     gagtaccggg cggtgacaga gctggggcgg cctgatgccg agtactggaa cagccagaag       180
     gacttcctgg aagacaggcg ggccctggtg gacacctact gcagacacaa ctacggggtt       240
     ggtgagagct tcacggtg                                                     258
//


spacer
spacer