spacer

EBI Dbfetch

ID   AF327742; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AF327742;
XX
DT   15-FEB-2001 (Rel. 66, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Hurley C., Tang T., Li L.;
RT   "Human Leokocyte Antigen Class II DRB1*0701 Variant";
RL   Unpublished.
XX
RN   [2]
RP   1-276
RA   Hurley C., Tang T., Li L.;
RT   ;
RL   Submitted (11-DEC-2000) to the INSDC.
RL   Microbiology & Immunology, Georgetown University, 3970 Reservoir Rd.,
RL   Washington D.C. 20057, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            19..>276
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   mRNA            <19..>276
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <19..>276
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q9BD35"
FT                   /db_xref="IMGT/HLA:DRB1*07:05"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9BD35"
FT                   /protein_id="AAK08492.1"
FT                   /translation="RFLWQGKYKCHFFNGTERVQFLERLFYNQEEFVRFDSDVGEYRAV
FT                   TELGRPVAESWNSRKDILEDRRGQVDTVCRHNYGVGESFT"
XX
SQ   Sequence 276 BP; 57 A; 67 C; 99 G; 53 T; 0 other;
     tcgtttgtgc ccccacagca cgtttcctgt ggcagggtaa gtataagtgt catttcttca        60
     acgggacgga gcgggtgcag ttcctggaaa gactcttcta taaccaggag gagttcgtgc       120
     gcttcgacag cgacgtgggg gagtaccggg cggtgacgga gctagggcgg cctgtcgccg       180
     agtcctggaa cagccggaag gacatcctgg aggacaggcg gggccaggtg gacaccgtgt       240
     gcagacacaa ctacggggtt ggtgagagct tcacag                                 276
//


spacer
spacer