spacer

EBI Dbfetch

ID   AF326565; SV 1; linear; genomic DNA; STD; HUM; 261 BP.
XX
AC   AF326565;
XX
DT   07-FEB-2001 (Rel. 66, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DPB1) gene, HLA-DPB1*02014 allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-261
RX   DOI; 10.1034/j.1399-0039.2002.590113.x.
RX   PUBMED; 11972883.
RA   Curcio M., Lapi S., Italia S., Rizzo G.;
RT   "Identification of a novel HLA-DPB1 allele, DPB1*02014, by sequence-based
RT   typing";
RL   Tissue Antigens 59(1):58-59(2002).
XX
RN   [2]
RP   1-261
RA   Curcio M., Lapi S.;
RT   ;
RL   Submitted (05-DEC-2000) to the INSDC.
RL   Laboratory of Immunogenetics-Nephrology Unit, S. Chiara Hospital, via Roma
RL   57, Pisa 56100, Italy
XX
DR   MD5; 2dcc16cc7ce8e8cdc39095aa26f4a5f8.
DR   Ensembl-Gn; ENSG00000229295; homo_sapiens.
DR   Ensembl-Tr; ENST00000415996; homo_sapiens.
DR   Ensembl-Tr; ENST00000445925; homo_sapiens.
DR   Ensembl-Tr; ENST00000447783; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..261
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>261
FT                   /gene="HLA-DPB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>261
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q9BD36"
FT                   /db_xref="IMGT/HLA:DPB1*02:01:04"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9BD36"
FT                   /protein_id="AAK01673.1"
FT                   /translation="NYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTE
FT                   LGRPDEEYWNSQKDILEEERAVPDRMCRHNYELGGPMTLQR"
XX
SQ   Sequence 261 BP; 60 A; 64 C; 95 G; 42 T; 0 other;
     agaattacct tttccaggga cggcaggaat gctacgcgtt taatgggaca cagcgcttcc        60
     tggagagata catctacaac cgggaggagt tcgtgcgctt cgacagcgac gtgggggagt       120
     tccgggcggt gacggagctg gggcggcctg atgaggagta ctggaacagc cagaaggaca       180
     tcctggagga ggagcgggca gttccggaca ggatgtgcag acacaactac gagctgggcg       240
     ggcccatgac cctgcagcgc c                                                 261
//


spacer
spacer