spacer

EBI Dbfetch

ID   AF312697; SV 1; linear; genomic DNA; STD; HUM; 1685 BP.
XX
AC   AF312697;
XX
DT   21-APR-2001 (Rel. 67, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-G) gene, HLA-G*0106 allele, exons 2,
DE   3, and 4, and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1685
RX   DOI; 10.1007/s002510100296.
RX   PUBMED; 11261931.
RA   Hviid T.V., Christiansen O.B., Johansen J.K., Hviid U.R., Lundegaard C.,
RA   Moller C., Morling N.;
RT   "Characterization of a new HLA-G allele encoding a nonconservative amino
RT   acid substitution in the alpha3 domain (exon 4) and its relevance to
RT   certain complications in pregnancy";
RL   Immunogenetics 53(1):48-53(2001).
XX
RN   [2]
RP   1-1685
RA   Hviid T.V., Christiansen O.B., Johansen J.K., Hviid U.R., Lundegaard C.,
RA   Moller C., Morling N.;
RT   ;
RL   Submitted (11-OCT-2000) to the INSDC.
RL   Dept. of Clinical Biochemistry, Copenhagen University Hospital, 30
RL   Kettegaard Alle, Hvidovre DK-2650, Denmark
XX
DR   MD5; 0f9d0955a45c64b7ca17a31d172fe971.
DR   Ensembl-Gn; ENSG00000264751; homo_sapiens.
DR   Ensembl-Tr; ENST00000582523; homo_sapiens.
DR   Ensembl-Tr; ENST00000583373; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1685
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<18..287,515..790,1390..>1665)
FT                   /gene="HLA-G"
FT                   /product="MHC class I antigen"
FT   exon            18..287
FT                   /gene="HLA-G"
FT                   /note="number=2"
FT   CDS             join(<18..287,515..790,1390..>1665)
FT                   /codon_start=3
FT                   /gene="HLA-G"
FT                   /product="MHC class I antigen"
FT                   /note="histocompatibility antigen"
FT                   /db_xref="GOA:Q9BCT7"
FT                   /db_xref="IMGT/HLA:G*01:06"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q9BCT7"
FT                   /protein_id="AAK38203.1"
FT                   /translation="SHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRME
FT                   PRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGS
FT                   DGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTC
FT                   VEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGED
FT                   QTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYMCHVQHEGLPEPLMLRW"
FT   exon            515..790
FT                   /gene="HLA-G"
FT                   /note="number=3"
FT   exon            1390..1665
FT                   /gene="HLA-G"
FT                   /note="number=4"
XX
SQ   Sequence 1685 BP; 333 A; 512 C; 538 G; 302 T; 0 other;
     cctctcctcg cccccaggct cccactccat gaggtatttc agcgccgccg tgtcccggcc        60
     cggccgcggg gagccccgct tcatcgccat gggctacgtg gacgacacgc agttcgtgcg       120
     gttcgacagc gactcggcgt gtccgaggat ggagccgcgg gcgccgtggg tggagcagga       180
     ggggccagag tattgggaag aggagacacg gaacaccaag gcccacgcac agactgacag       240
     aatgaacctg cagaccctgc gcggctacta caaccagagc gaggccagtg agtaaccccg       300
     gcccagggcg cagatcacga ccccccacct ccatgcccca cggacgcccc gggtactccc       360
     gagtctccgg gtctgggatc caccccgagg ccgcgggacc cgcccagacc ctctacctgg       420
     gagaacccca aggcgccttt accaaaatcc ctgcgggtgg gtccgggcga gggcgaggct       480
     cggtgggcgg ggctgaccga gggggtgggg ccaggttctc ataccctcca gtggatgatt       540
     ggctgcgacc tggggtccga cggacgcctc ctccgcgggt atgaacagta tgcctacgat       600
     ggcaaggatt acctcgccct gaacgaggac ctgcgctcct ggaccgcagc ggacactgcg       660
     gctcagatct ccaagcgcaa gtgtgaggcg gccaatgtgg ctgaacaaag gagagcctac       720
     ctggagggca cgtgcgtgga gtggctccac agatacctgg agaacgggaa ggagatgctg       780
     cagcgcgcgg gtaccagggg cagtggggcg cctccctgat ctcctgtaga cctcccagcc       840
     tggcctagca caaggagagg aggaaaatgg gaccaacacc agaatatcgc cctccctctg       900
     gtcctgaggg agaggaatcc tcctgggttt ccagatcctg taccagagag tgattctgag       960
     ggcccgtcct gctctctggg acaattaagg gatgaagtct ctgagggagt ggaggggaag      1020
     acaatccctg gaggactgat caggggttcc ctttgacccc acagcagcct tggcaccagg      1080
     acttttcccc tcaggccttg ttctctgcct cacactcaat gtgtgtggga gtctgactcc      1140
     agctcctctg agtcccttgg cctccactca ggtcagaacc agaggtccct gctcccccgc      1200
     tcagagacta gaactttcca aggaatagga gattatccca ggtgcccgtg tccaggctgg      1260
     tgtctgggtt ctgtgctccc ttccccaccc caggtatctg gttcattctt aggatggtca      1320
     catccaggtg ctgctggagt gtcccatgag agatgcaaag tgcttgagtt ttctgactct      1380
     tcctttcaga cccccccaag acacacgtga cccaccaccc tgtctttgac tatgaggcca      1440
     ccctgaggtg ctgggccctg ggcttctacc ctgcggagat catactgacc tggcagcggg      1500
     atggggagga ccagacccag gacgtggagc tcgtggagac caggcctgca ggggatggaa      1560
     ccttccagaa gtgggcagct gtggtggtgc cttctggaga ggagcagaga tacatgtgcc      1620
     atgtgcagca tgaggggctg ccggagcccc tcatgctgag atggagtaag gagggagatg      1680
     gaggc                                                                  1685
//


spacer
spacer