Dbfetch

ID   AF305699; SV 2; linear; mRNA; STD; HUM; 1082 BP.
XX
AC   AF305699;
XX
DT   08-NOV-2000 (Rel. 65, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Homo sapiens MHC class I antigen precursor (HLA-A) mRNA, HLA-A*0214 allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1082
RX   DOI; 10.1007/s002510100299.
RX   PUBMED; 11261925.
RA   Luscher M.A., MacDonald K.S., Bwayo J.J., Plummer F.A., Barber B.H.;
RT   "Sequence and peptide-binding motif for a variant of HLA-A*0214 (A*02142)
RT   in an HIV-1-resistant individual from the Nairobi Sex Worker cohort";
RL   Immunogenetics 53(1):10-14(2001).
XX
RN   [2]
RC   Erratum
RP   1-1082
RA   Luscher M.A., Su J., MacDonald K.S., Bwayo J.J., Plummer F.A., Barber B.H.;
RT   "Erratum: Sequence and peptide-binding motif for a variant of HLA-A*0214
RT   (A*02142) in an HIV-1-resistant individual from the Nairobi Sex Worker
RT   cohort";
RL   Immunogenetics 53(8):717-717(2001).
XX
RN   [3]
RP   1-1082
RA   Luscher M.A., MacDonald K.S., Bwayo J.J., Plummer F.A., Barber B.H., Su J.;
RT   ;
RL   Submitted (14-SEP-2000) to the INSDC.
RL   Division of Clinical Sciences, University of Toronto, 6366-1 King's College
RL   Circle, Toronto, ON M5S 1A8, Canada
XX
DR   MD5; 03ac570fb3b4db4f259d32e222f6e5fe.
DR   H-InvDB; HIT000076784_03.4.
XX
CC   On Aug 3, 2001 this sequence version replaced gi:11120554.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1082
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /country="Kenya"
FT                   /sex="female"
FT                   /cell_line="ML1260"
FT                   /cell_type="EBV-transformed B cell"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>1082
FT                   /codon_start=2
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen precursor"
FT                   /note="human leukocyte antigen"
FT                   /db_xref="GOA:Q9GJ24"
FT                   /db_xref="H-InvDB:HIT000076784_02.4"
FT                   /db_xref="IMGT/HLA:A*02:14"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q9GJ24"
FT                   /protein_id="AAG30922.2"
FT                   /translation="VMAPRTLVLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGEPRFI
FT                   AVGYVDDTQFVRFDSDAASRRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLR
FT                   GYYNQSEAGSHTLQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQ
FT                   TTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEAT
FT                   LRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTC
FT                   HVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRKGG
FT                   SYSQAASSDSAQGSDVSLTA"
FT   sig_peptide     <1..67
FT                   /gene="HLA-A"
FT   misc_feature    68..340
FT                   /gene="HLA-A"
FT                   /note="Region: alpha-1 domain"
FT   misc_feature    338..616
FT                   /gene="HLA-A"
FT                   /note="Region: alpha-2 domain"
FT   misc_feature    614..892
FT                   /gene="HLA-A"
FT                   /note="Region: alpha-3 domain"
FT   misc_feature    890..1009
FT                   /gene="HLA-A"
FT                   /note="Region: transmembrane domain"
FT   misc_feature    1007..1082
FT                   /gene="HLA-A"
FT                   /note="Region: intracellular domain"
XX
SQ   Sequence 1082 BP; 214 A; 323 C; 363 G; 182 T; 0 other;
     cgtcatggcg ccccgaaccc tcgtcctgct actctcgggg gctctggccc tgacccagac        60
     ctgggcgggc tctcactcca tgaggtattt ctacacctcc gtgtcccggc ccggccgcgg       120
     ggagccccgc ttcatcgcag tgggctacgt ggacgacacg cagttcgtgc ggttcgacag       180
     cgacgccgcg agccggagga tggagccgcg ggcgccgtgg atagagcagg agggtccgga       240
     gtattgggac ggggagacac ggaaagtgaa ggcccactca cagactcacc gagtggacct       300
     ggggaccctg cgcggctact acaaccagag cgaggccggt tctcacaccc tccagaggat       360
     gtatggctgc gacgtggggt cggactggcg cttcctgcgc gggtaccacc agtacgccta       420
     cgacggcaag gattacatcg ccctgaaaga ggacctgcgc tcttggaccg cggcggacat       480
     ggcagctcag accaccaagc acaagtggga ggcggcccat gtggcggagc agttgagagc       540
     ctacctggag ggcacgtgcg tggagtggct ccgcagatac ctggagaacg ggaaggagac       600
     gctgcagcgc acggacgccc ccaaaacgca tatgactcac cacgctgtct ctgaccatga       660
     agccaccctg aggtgctggg ccctgagctt ctaccctgcg gagatcacac tgacctggca       720
     gcgggatggg gaggaccaga cccaggacac ggagctcgtg gagaccaggc ctgcagggga       780
     tggaaccttc cagaagtggg cggctgtggt ggtgccttct ggacaggagc agagatacac       840
     ctgccatgtg cagcatgagg gtttgcccaa gcccctcacc ctgagatggg agccgtcttc       900
     ccagcccacc atccccatcg tgggcatcat tgctggcctg gttctctttg gagctgtgat       960
     cactggagct gtggtcgctg ctgtgatgtg gaggaggaag agctcagata gaaaaggagg      1020
     gagctactct caggctgcaa gcagtgacag tgcccagggc tctgatgtgt ctctcacagc      1080
     tt                                                                     1082
//