Dbfetch

ID   AF304866; SV 1; linear; genomic DNA; STD; HUM; 436 BP.
XX
AC   AF304866;
XX
DT   14-OCT-2000 (Rel. 65, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen DR beta 1 chain (HLA-DRB1) gene,
DE   HLA-DRB1*04 variant allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-436
RX   DOI; 10.1034/j.1399-0039.2001.580311.x.
RX   PUBMED; 11703831.
RA   Dunn T.A., Iglehart B.A., Leffell M.S.;
RT   "Identification of a novel DR4 allele, DRB1*0442";
RL   Tissue Antigens 58(3):198-200(2001).
XX
RN   [2]
RP   1-436
RA   Dunn T.A., Iglehart B.A., Leffell M.S.;
RT   ;
RL   Submitted (12-SEP-2000) to the INSDC.
RL   Medicine, Johns Hopkins University, 2041 E. Monument St., Baltimore, MD
RL   21205, USA
XX
DR   MD5; 11afd28b000a831b4241aa38e21e3ca6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..436
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            127..396
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   mRNA            <127..>396
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen DR beta 1 chain"
FT   CDS             <127..>396
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen DR beta 1 chain"
FT                   /db_xref="GOA:Q9GJ28"
FT                   /db_xref="IMGT/HLA:DRB1*04:42"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9GJ28"
FT                   /protein_id="AAG22827.1"
FT                   /translation="RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVVESFTVQRR"
XX
SQ   Sequence 436 BP; 78 A; 116 C; 161 G; 81 T; 0 other;
     cccccgtccg cctcagaaag acagaggatg agcccctggg ctgcgtgttg tcggggttgc        60
     gggtggggcc agatagtgtc ttccccggag gccgcttctg taaccggatc gttcttgtcc       120
     ccccagcacg tttcttggag caggttaaac atgagtgtca tttcttcaac gggacggagc       180
     gggtgcggtt cctggacaga tacttctatc accaagagga gtacgtgcgc ttcgacagcg       240
     acgtggggga gttccgggcg gtgacggagc tggggcggcc tgatgccgag tactggaaca       300
     gccagaagga cctcctggag cagaggcggg ccgcggtgga cacctactgc agacacaact       360
     acggggttgt ggagagcttc acagtgcagc ggcgaggtga gcgcggcgcg gggcggggcc       420
     tgagtccctg tgagcg                                                       436
//