spacer

EBI Dbfetch

ID   AH009869; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AH009869; AF303101-AF303102;
XX
DT   30-JUN-2011 (Rel. 109, Created)
DT   30-JUN-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*3701 variant allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RX   DOI; 10.1034/j.1399-0039.2002.590310.x.
RX   PUBMED; 12074716.
RA   Gans C.P., Mitton W., Ng J., Hartzman R.J., Hurley C.K.;
RT   "Seven new HLA-B alleles associated with antigens in the B7 CREG";
RL   Tissue Antigens 59(3):229-231(2002).
XX
RN   [2]
RP   1-646
RA   Gans C.P., Hurley C.K.;
RT   "Novel HLA-B Allele";
RL   Unpublished.
XX
RN   [3]
RP   1-646
RA   Gans C.P., Hurley C.K.;
RT   ;
RL   Submitted (06-SEP-2000) to the INSDC.
RL   Oncology, Georgetown University Medical Center, 3970 Reservoir Road, NW,
RL   Washington, DC 20007, USA
XX
DR   Ensembl-Gn; ENSG00000206450; homo_sapiens.
DR   Ensembl-Tr; ENST00000359635; homo_sapiens.
XX
CC   On or before Jun 29, 2011 this sequence version replaced
CC   gi:10644779, gi:10644780, gi:10644778.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3701 variant"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3701 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3701 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:P18463"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:P18463"
FT                   /protein_id="AAG21400.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYREDLRTLLRYYNQSEAGSHTIQRMSGCDVGP
FT                   DGRLLRGYNQFAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQDRAYLEGTC
FT                   VEWLRRHLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3701 variant"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3701 variant"
FT                   /number=3
XX
SQ   Sequence 646 BP; 110 A; 176 C; 188 G; 72 T; 100 other;
     gctcccactc catgaggtat ttccacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagaggac ctgcggaccc       240
     tgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac catccagagg atgtctggct gcgacgtggg gccggacggg       420
     cgcctcctcc gcgggtataa ccagttcgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctga gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgtggcgga gcaggacaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagac acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//


spacer
spacer