Dbfetch

ID   AF288355; SV 1; linear; genomic DNA; STD; HUM; 277 BP.
XX
AC   AF288355;
XX
DT   06-NOV-2000 (Rel. 65, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens isolate 009519430 MHC class II antigen (HLA-DPB1) gene,
DE   HLA-DPB1*3701 variant allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-277
RA   Grams S.E., Begovich A.B., Noreen H.;
RT   ;
RL   Submitted (19-JUL-2000) to the INSDC.
RL   Human Genetics, Roche Molecular Systems, 1145 Atlantic Ave., Alameda, CA
RL   94501, USA
XX
DR   MD5; 90ae20513d9fd06e2bf6405e11e9b5cf.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..277
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p"
FT                   /isolate="009519430"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <14..>277
FT                   /gene="HLA-DPB1"
FT                   /product="MHC class II antigen"
FT   CDS             <14..>277
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q9GJ40"
FT                   /db_xref="IMGT/HLA:DPB1*88:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9GJ40"
FT                   /protein_id="AAG30144.1"
FT                   /translation="NYVYQLRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTE
FT                   LGRPDEDYWNSQKDILEEERAVPDRVCRHNYELDEAVTLQRR"
XX
SQ   Sequence 277 BP; 64 A; 72 C; 99 G; 42 T; 0 other;
     cccctccccg cagagaatta cgtgtaccag ttacggcagg aatgctacgc gtttaatggg        60
     acacagcgct tcctggagag atacatctac aaccgggagg agttcgtgcg cttcgacagc       120
     gacgtggggg agttccgggc ggtgacggag ctggggcggc ctgatgagga ctactggaac       180
     agccagaagg acatcctgga ggaggagcgg gcagtgccgg acagggtatg cagacacaac       240
     tacgagctgg acgaggccgt gaccctgcag cgccgag                                277
//