spacer

EBI Dbfetch

ID   AF280436; SV 1; linear; genomic DNA; STD; HUM; 266 BP.
XX
AC   AF280436;
XX
DT   07-AUG-2000 (Rel. 64, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*1103v allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-266
RA   Robbins F.-M., Yao H., Hurley C.;
RT   "Human MHC class II antigen HLA-DRB1*1103v, new allele";
RL   Unpublished.
XX
RN   [2]
RP   1-266
RA   Robbins F.-M., Yao H., Hurley C.;
RT   ;
RL   Submitted (20-JUN-2000) to the INSDC.
RL   Pediatrics, Georgetown University/NMRC, 5516 Nicholson Lane, Kensington, MD
RL   20895, USA
XX
DR   MD5; 74b7110178cdda8959e034d63be74e90.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..266
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="DRB1*1103v, DRB3*02021"
FT                   /tissue_type="cord blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>266
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   exon            <1..266
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   CDS             <1..>266
FT                   /codon_start=2
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:Q9MY77"
FT                   /db_xref="IMGT/HLA:DRB1*11:41"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9MY77"
FT                   /protein_id="AAF97594.1"
FT                   /translation="FLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAVT
FT                   ELGRPDEEYWNSQKDFLEDERAAVDTYCRHNYGVVESFTVQRR"
XX
SQ   Sequence 266 BP; 58 A; 60 C; 96 G; 52 T; 0 other;
     tttcttggag tactctacgt ctgagtgtca tttcttcaat gggacggagc gggtgcggtt        60
     cctggacaga tacttctata accaagagga gtacgtgcgc ttcgacagcg acgtggggga       120
     gtaccgggcg gtgacggagc tggggcggcc tgatgaggag tactggaaca gccagaagga       180
     cttcctggaa gacgagcggg ccgcggtgga cacctactgc agacacaact acggggttgt       240
     ggagagcttc acagtgcagc ggcgag                                            266
//


spacer
spacer