Dbfetch

ID   AF278701; SV 1; linear; genomic DNA; STD; HUM; 234 BP.
XX
AC   AF278701;
XX
DT   29-JUL-2000 (Rel. 64, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*8 allele, exon
DE   2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-234
RA   Lopez-Nevot M.A., Garrido A., Garrido F.;
RT   "A new HLA-DRB1*8 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-234
RA   Lopez-Nevot M.A., Garrido A., Garrido F.;
RT   ;
RL   Submitted (15-JUN-2000) to the INSDC.
RL   Immunology, Hospital Virgen de las Nieves, Avenida Fuerzas Armadas, Granada
RL   18014, Spain
XX
DR   MD5; 6f665a7e474bd28ac8da9cf450c63dfc.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..234
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>234
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   exon            1..234
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   CDS             <1..>234
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q9MY83"
FT                   /db_xref="IMGT/HLA:DRB1*08:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9MY83"
FT                   /protein_id="AAF87751.1"
FT                   /translation="ECYFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAVTELGRPSA
FT                   EYWNSQKDFLEDRRALVDTYCRHNYGVGESFTV"
XX
SQ   Sequence 234 BP; 51 A; 54 C; 86 G; 43 T; 0 other;
     gagtgttatt tcttcaatgg gacggagcgg gtgcggttcc tggacagata cttctataac        60
     caagaggagt acgtgcgctt cgacagcgac gtgggggagt accgggcggt gacggagctg       120
     gggcggccta gcgccgagta ctggaacagc cagaaggact tcctggaaga caggcgggcc       180
     ctggtggaca cctactgcag acacaactac ggggttggtg agagcttcac ggtg             234
//