spacer

EBI Dbfetch

ID   AH010821; SV 2; linear; genomic DNA; STD; HUM; 2385 BP.
XX
AC   AH010821; AF264744; AF264746-AF264747;
XX
DT   30-JUN-2011 (Rel. 109, Created)
DT   30-JUN-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I chain-related protein A (MICA) gene, MICA*00901
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2385
RX   DOI; 10.1034/j.1399-0039.2001.057006520.x.
RX   PUBMED; 11556982.
RA   Obuchi N., Takahashi M., Nouchi T., Satoh M., Arimura T., Ueda K., Akai J.,
RA   Ota M., Naruse T., Inoko H., Numano F., Kimura A.;
RT   "Identification of MICA alleles with a long Leu-repeat in the transmembrane
RT   region and no cytoplasmic tail due to a frameshift-deletion in exon 4";
RL   Tissue Antigens 57(6):520-535(2001).
XX
RN   [2]
RP   1-2385
RA   Obuchi N., Kimura A.;
RT   ;
RL   Submitted (08-MAY-2000) to the INSDC.
RL   Molecular Pathology, Medical Research Institute, Tokyo Medical and Dental
RL   University, 2-3-10 Kanda-Surugadai, Chiyoda-Ku, Tokyo 101-0062, Japan
XX
DR   Ensembl-Gn; ENSG00000183214; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235233; homo_sapiens.
DR   Ensembl-Tr; ENST00000400325; homo_sapiens.
DR   Ensembl-Tr; ENST00000418465; homo_sapiens.
DR   Ensembl-Tr; ENST00000547609; homo_sapiens.
DR   IMGT/LIGM; AH010821.
XX
CC   On or before Jun 29, 2011 this sequence version replaced
CC   gi:14279226, gi:14279227, gi:14279228, gi:14279225.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2385
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="LUY"
FT                   /cell_type="B-lymphoblastoid"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2385
FT                   /gene="MICA"
FT                   /allele="MICA*00901"
FT   mRNA            join(<25..279,554..841,1553..1831,1931..2068,2208..>2385)
FT                   /gene="MICA"
FT                   /allele="MICA*00901"
FT                   /product="MHC class I chain-related protein A"
FT   CDS             join(<25..279,554..841,1553..1831,1931..2068,2208..2335)
FT                   /codon_start=3
FT                   /gene="MICA"
FT                   /allele="MICA*00901"
FT                   /product="MHC class I chain-related protein A"
FT                   /db_xref="GOA:Q29983"
FT                   /db_xref="HGNC:HGNC:7090"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1B3J"
FT                   /db_xref="PDB:1HYR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29983"
FT                   /protein_id="AAK58538.1"
FT                   /translation="PHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQ
FT                   GQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTR
FT                   SSQHFYYDGELFLSQNVETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADC
FT                   LQELRRYLESSVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNITLTWRQDGVSL
FT                   SHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQS
FT                   HWQTFHVSAVAAAAAAIFVIIIFYVRCCKKKTSAAEGPELVSLQVLDQHPVGMSDHRDA
FT                   TQLGFQPLMSALGSTGSTEGA"
FT   exon            25..279
FT                   /gene="MICA"
FT                   /allele="MICA*00901"
FT                   /number=2
FT   exon            554..841
FT                   /gene="MICA"
FT                   /allele="MICA*00901"
FT                   /number=3
FT   gap             1429..1528
FT                   /estimated_length=unknown
FT   exon            1553..1831
FT                   /gene="MICA"
FT                   /allele="MICA*00901"
FT                   /number=4
FT   exon            1931..2068
FT                   /gene="MICA"
FT                   /allele="MICA*00901"
FT                   /number=5
FT   gap             2076..2175
FT                   /estimated_length=unknown
FT   exon            2208..>2385
FT                   /gene="MICA"
FT                   /allele="MICA*00901"
FT                   /number=6
FT   3'UTR           2336..>2385
FT                   /gene="MICA"
FT                   /allele="MICA*00901"
XX
SQ   Sequence 2385 BP; 486 A; 592 C; 644 G; 463 T; 200 other;
     cacctgtgat ttcctcttcc ccagagcccc acagtcttcg ttataacctc acggtgctgt        60
     cctgggatgg atctgtgcag tcagggtttc ttgctgaggt acatctggat ggtcagccct       120
     tcctgcgcta tgacaggcag aaatgcaggg caaagcccca gggacagtgg gcagaagatg       180
     tcctgggaaa taagacatgg gacagagaga ccagggactt gacagggaac ggaaaggacc       240
     tcaggatgac cctggctcat atcaaggacc agaaagaagg tgagagtcgg caggggcaag       300
     agtgactgga gaggcctttt ccagaaaagt taggggcaga gagcagggac ctgtctcttc       360
     ccactggatc tggctcaggc tgggggtgag gaatgggggt cagtggaact cagcagggag       420
     gtgagccggc actcagccca cacagggagg catgggggag ggccagggag gcgtactccc       480
     tgggctgagt tcctcacttg ggtggaaagg tgatgggttc gggaatggag aagtcactgc       540
     tgggtggggg caggcttgca ttccctccag gagattaggg tctgtgagat ccatgaagac       600
     aacagcacca ggagctccca gcatttctac tacgatgggg agctcttcct ctcccaaaac       660
     gtggagactg aggaatggac agtgccccag tcctccagag ctcagacctt ggccatgaac       720
     gtcaggaatt tcttgaagga agatgccatg aagaccaaga cacactatca cgctatgcat       780
     gcagactgcc tgcaggaact acggcgatat ctagaatcca gcgtagtcct gaggagaaca       840
     ggtacggacg ctggccaggg gctctcctct ccctccaatt ctgctagagt tgcctcacct       900
     ccaagatgtg tccagggaaa ccctccctgt gctatggatg aaggcatttc ctgttggcac       960
     atcgtgtcct gattttcctc tattgttaga gccactggat aaagacagtg ggtcagggac      1020
     tggaccatcc agtgttgtaa tcagggcaag tagaggaccc tccgacagaa tcctgagcct      1080
     gtggtgggtg tcaggcagga gaggaagcct tcagggccag ggctgccccc tctgcctccc      1140
     agcctgccca tcctggagag ttccctcctg gccccacaac ccaggagtcc acccctgaca      1200
     tccccctcct cagcatcaat gtggggatcc cagagcctga ggccacagtc ccaaggccca      1260
     tcctcctgcc agcctggaag aactgggccc cagagtgagg acagacttgc aggtcagggg      1320
     tcccggaggg cttcagccag agtgagaaca gtgaagagaa acagccctgt tcctctcccc      1380
     tccttagagg ggagcagggc ttcactggct ctgccctttc ttctccagnn nnnnnnnnnn      1440
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1500
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnct ggctctgccc tttcttctcc agtgcccccc      1560
     atggtgaatg tcacccgcag cgaggcctca gagggcaaca tcaccgtgac atgcagggct      1620
     tccagcttct atccccggaa tatcacactg acctggcgtc aggatggggt atctttgagc      1680
     cacgacaccc agcagtgggg ggatgtcctg cctgatggga atggaaccta ccagacctgg      1740
     gtggccacca ggatttgcca aggagaggag cagaggttca cctgctacat ggaacacagc      1800
     gggaatcaca gcactcaccc tgtgccctct ggtgagccta gggtgaccct ggagagggtc      1860
     aggccagggt agggacagca gggatggctg tggctctctg cccagtgtat aacaagtccc      1920
     tttttttcag ggaaagtgct ggtgcttcag agtcattggc agacattcca tgtttctgct      1980
     gttgctgctg ctgctgctgc tatttttgtt attattattt tctatgtccg ttgttgtaag      2040
     aagaaaacat cagctgcaga gggtccaggt gagaannnnn nnnnnnnnnn nnnnnnnnnn      2100
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2160
     nnnnnnnnnn nnnnnggagc atttacccat ttccctcttt tctccagagc tcgtgagcct      2220
     gcaggtcctg gatcaacacc cagttgggat gagtgaccac agggatgcca cacagctcgg      2280
     atttcagcct ctgatgtcag ctcttgggtc cactggctcc actgagggcg cctagactct      2340
     acagccaggc ggctggaatt gaattccctg cctggatctc acaag                      2385
//


spacer
spacer