spacer

EBI Dbfetch

ID   AH010820; SV 2; linear; genomic DNA; STD; HUM; 2351 BP.
XX
AC   AH010820; AF264741-AF264743;
XX
DT   30-JUN-2011 (Rel. 109, Created)
DT   30-JUN-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I chain-related protein A (MICA) gene, MICA*048
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2351
RX   DOI; 10.1034/j.1399-0039.2001.057006520.x.
RX   PUBMED; 11556982.
RA   Obuchi N., Takahashi M., Nouchi T., Satoh M., Arimura T., Ueda K., Akai J.,
RA   Ota M., Naruse T., Inoko H., Numano F., Kimura A.;
RT   "Identification of MICA alleles with a long Leu-repeat in the transmembrane
RT   region and no cytoplasmic tail due to a frameshift-deletion in exon 4";
RL   Tissue Antigens 57(6):520-535(2001).
XX
RN   [2]
RP   1-2351
RA   Obuchi N., Kimura A.;
RT   ;
RL   Submitted (08-MAY-2000) to the INSDC.
RL   Molecular Pathology, Medical Research Institute, Tokyo Medical and Dental
RL   University, 2-3-10 Kanda-Surugadai, Chiyoda-Ku, Tokyo 101-0062, Japan
XX
DR   Ensembl-Gn; ENSG00000183214; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235233; homo_sapiens.
DR   Ensembl-Tr; ENST00000400325; homo_sapiens.
DR   Ensembl-Tr; ENST00000418465; homo_sapiens.
DR   Ensembl-Tr; ENST00000547609; homo_sapiens.
DR   IMGT/LIGM; AH010820.
XX
CC   On or before Jun 29, 2011 this sequence version replaced
CC   gi:14279221, gi:14279222, gi:14279223, gi:14279220.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2351
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="leukocytes"
FT                   /note="individual TA21"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2351
FT                   /gene="MICA"
FT                   /allele="MICA*048"
FT   mRNA            join(<25..279,554..841,1529..1807,1907..2041,2177..>2351)
FT                   /gene="MICA"
FT                   /allele="MICA*048"
FT                   /product="MHC class I chain-related protein A"
FT   CDS             join(<25..279,554..841,1529..1807,1907..2041,2177..2304)
FT                   /codon_start=3
FT                   /gene="MICA"
FT                   /allele="MICA*048"
FT                   /product="MHC class I chain-related protein A"
FT                   /db_xref="GOA:Q29983"
FT                   /db_xref="HGNC:HGNC:7090"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1B3J"
FT                   /db_xref="PDB:1HYR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29983"
FT                   /protein_id="AAK58537.1"
FT                   /translation="PHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQ
FT                   GQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTR
FT                   SSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADC
FT                   LQELRRYLESGVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSL
FT                   SHDTQQWGDVLPDGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQS
FT                   HWQTFHVSAVAAAAAIFVIIIFYVRCCKKKTSAAEGPELVSLQVLDQHPVGTSDHRDAT
FT                   QLGFQPLMSALGSTGSTEGA"
FT   exon            25..279
FT                   /gene="MICA"
FT                   /allele="MICA*048"
FT                   /number=2
FT   exon            554..841
FT                   /gene="MICA"
FT                   /allele="MICA*048"
FT                   /number=3
FT   gap             1429..1528
FT                   /estimated_length=unknown
FT   exon            1529..1807
FT                   /gene="MICA"
FT                   /allele="MICA*048"
FT                   /number=4
FT   exon            1907..2041
FT                   /gene="MICA"
FT                   /allele="MICA*048"
FT                   /number=5
FT   gap             2042..2141
FT                   /estimated_length=unknown
FT   exon            2177..>2351
FT                   /gene="MICA"
FT                   /allele="MICA*048"
FT                   /number=6
FT   3'UTR           2305..>2351
FT                   /gene="MICA"
FT                   /allele="MICA*048"
XX
SQ   Sequence 2351 BP; 480 A; 584 C; 634 G; 453 T; 200 other;
     cacctgtgat ttcctcttcc ccagagcccc acagtcttcg ttataacctc acggtgctgt        60
     cctgggatgg atctgtgcag tcagggtttc ttgctgaggt acatctggat ggtcagccct       120
     tcctgcgcta tgacaggcag aaatgcaggg caaagcccca gggacagtgg gcagaagatg       180
     tcctgggaaa taagacatgg gacagagaga ccagggactt gacagggaac ggaaaggacc       240
     tcaggatgac cctggctcat atcaaggacc agaaagaagg tgagagtcgg caggggcaag       300
     agtgactgga gaggcctttt ccagaaaagt taggggcaga gagcagggac ctgtctcttc       360
     ccactggatc tggctcaggc tgggggtgag gaatgggggt cagtggaact cagcagggag       420
     gtgagccggc actcagccca cacagggagg catggaggag ggccagggag gcataccccc       480
     tgggctgagt tcctcacttg ggtggaaagg tgatgggttc gggaatggag aagtcactgc       540
     tgggtggggg caggcttgca ttccctccag gagattaggg tctgtgagat ccatgaagac       600
     aacagcacca ggagctccca gcatttctac tacgatgggg agctcttcct ctcccaaaac       660
     ctggagactg aggaatggac agtgccccag tcctccagag ctcagacctt ggccatgaac       720
     gtcaggaatt tcttgaagga agatgccatg aagaccaaga cacactatca cgctatgcat       780
     gcagactgcc tgcaggaact acggcgatat ctagaatccg gcgtagtcct gaggagaaca       840
     ggtaccgacg ctggccaggg gctctcctct ccctccaatt ctgctagagt tgcctcacct       900
     cccagatgtg tccagggaaa ccctccctgt gctatggatg aaggcatttc ctgttggcac       960
     atcgtgtcct gattttcctc tattgttaga gccactggat aaagacagtg ggtcagggac      1020
     tggaccatcc agtgttgtaa tcagggcaag tagaggaccc tccgacagaa tcctgagcct      1080
     gtggtgggtg tcaggtagga gaggaagcct tcagggccag ggctgccccc tctgcctccc      1140
     agcctgccca tcctggagag ttccctcctg gccccacaac ccaggagtcc acccctgaca      1200
     tccccctcct cagcatcaat gtggggatcc cagagcctga ggccacagtc ccaaggccca      1260
     tcctcctgcc agcctggaag aactgggccc cagagtgagg acagacttgc aggtcagggg      1320
     tcccggaggg cttcagccag agtgagaaca gtgaagagaa acagccctgt tcctctcccc      1380
     tccttagagg ggagcagggc ttcactggct ctgccctttc ttctccagnn nnnnnnnnnn      1440
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1500
     nnnnnnnnnn nnnnnnnnnn nnnnnnnntg ccccccatgg tgaatgtcac ccgcagcgag      1560
     gcctcagagg gcaacatcac cgtgacatgc agggcttcca gcttctatcc ccggaatatc      1620
     atactgacct ggcgtcagga tggggtatct ttgagccacg acacccagca gtggggggat      1680
     gtcctgcctg atgggaatgg aacctaccag acctgggtgg ccaccaggat ttgccgagga      1740
     gaggagcaga ggttcacctg ctacatggaa cacagcggga atcacagcac tcaccctgtg      1800
     ccctctggtg agcctagggt gaccctggag agggtcaggc cagggtaggg acagcaggga      1860
     tggctgtggc tctctgccca gtgtataaca agtccctttt tttcagggaa agtgctggtg      1920
     cttcagagtc attggcagac attccatgtt tctgctgttg ctgctgctgc tgctattttt      1980
     gttattatta ttttctatgt ccgttgttgt aagaagaaaa catcagctgc agagggtcca      2040
     gnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2100
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nagtggagca tttacccatt      2160
     tccctctttt ctccagagct cgtgagcctg caggtcctgg atcaacaccc agttgggacg      2220
     agtgaccaca gggatgccac acagctcgga tttcagcctc tgatgtcagc tcttgggtcc      2280
     actggctcca ctgagggcgc ctagactcta cagccaggcg gctggaattg aattccctgc      2340
     ctggatctca c                                                           2351
//


spacer
spacer