spacer

EBI Dbfetch

ID   AH011143; SV 2; linear; genomic DNA; STD; HUM; 1838 BP.
XX
AC   AH011143; AF264738-AF264740; AH007936;
XX
DT   30-JUN-2011 (Rel. 109, Created)
DT   30-JUN-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I chain-related protein A (MICA) gene, MICA*015
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1838
RX   DOI; 10.1034/j.1399-0039.2001.057006520.x.
RX   PUBMED; 11556982.
RA   Obuchi N., Takahashi M., Nouchi T., Satoh M., Arimura T., Ueda K., Akai J.,
RA   Ota M., Naruse T., Inoko H., Numano F., Kimura A.;
RT   "Identification of MICA alleles with a long Leu-repeat in the transmembrane
RT   region and no cytoplasmic tail due to a frameshift-deletion in exon 4";
RL   Tissue Antigens 57(6):520-535(2001).
XX
RN   [2]
RP   1-1838
RA   Obuchi N., Kimura A.;
RT   ;
RL   Submitted (08-MAY-2000) to the INSDC.
RL   Molecular Pathology, Medical Research Institute, Tokyo Medical and Dental
RL   University, 2-3-10 Kanda-Surugadai, Chiyoda-Ku, Tokyo 101-0062, Japan
XX
DR   MD5; e250d804581c34b284251a592b77d937.
DR   Ensembl-Gn; ENSG00000183214; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235233; homo_sapiens.
DR   Ensembl-Tr; ENST00000400325; homo_sapiens.
DR   Ensembl-Tr; ENST00000418465; homo_sapiens.
DR   Ensembl-Tr; ENST00000547609; homo_sapiens.
DR   IMGT/LIGM; AH011143.
XX
CC   On or before Jun 29, 2011 this sequence version replaced
CC   gi:16032981, gi:16032982, gi:16032983, gi:16032980.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1838
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="OMW"
FT                   /cell_type="B-lymphoblastoid"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1838
FT                   /gene="MICA"
FT                   /allele="MICA*015"
FT   mRNA            join(<25..279,554..841,990..1267,1368..1514,1661..>1838)
FT                   /gene="MICA"
FT                   /allele="MICA*015"
FT                   /product="MHC class I chain-related protein A"
FT   CDS             join(<25..279,554..841,990..1267,1368..1514,1661..1669)
FT                   /codon_start=3
FT                   /gene="MICA"
FT                   /allele="MICA*015"
FT                   /product="MHC class I chain-related protein A"
FT                   /db_xref="GOA:Q29983"
FT                   /db_xref="HGNC:HGNC:7090"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1B3J"
FT                   /db_xref="PDB:1HYR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29983"
FT                   /protein_id="AAL13171.1"
FT                   /translation="PHSLRYNLTVLSGDGSVQSGFLAEVHLDGQPFLRCDRQKCRAKPQ
FT                   GQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTR
FT                   SSQHFYYDRELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADC
FT                   LQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSL
FT                   SHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKCWCFRV
FT                   IGRHSMFLLLLLLLLLLLLFLLLLFSTSVVVRRKHQLQRVQSS"
FT   exon            25..279
FT                   /gene="MICA"
FT                   /allele="MICA*015"
FT                   /number=2
FT   exon            554..841
FT                   /gene="MICA"
FT                   /allele="MICA*015"
FT                   /number=3
FT   gap             866..965
FT                   /estimated_length=unknown
FT   exon            990..1267
FT                   /gene="MICA"
FT                   /allele="MICA*015"
FT                   /number=4
FT   exon            1368..1514
FT                   /gene="MICA"
FT                   /allele="MICA*015"
FT                   /number=5
FT   gap             1524..1623
FT                   /estimated_length=unknown
FT   exon            1661..>1838
FT                   /gene="MICA"
FT                   /allele="MICA*015"
FT                   /number=6
FT   3'UTR           1670..>1838
FT                   /gene="MICA"
FT                   /allele="MICA*015"
XX
SQ   Sequence 1838 BP; 377 A; 417 C; 495 G; 349 T; 200 other;
     cacctgtgat ttcctcttcc ccagagcccc acagtcttcg ttataacctc acggtgctgt        60
     ccggggatgg atctgtgcag tcagggtttc tcgctgaggt acatctggat ggtcagccct       120
     tcctgcgctg tgacaggcag aaatgcaggg caaagcccca gggacagtgg gcagaagatg       180
     tcctgggaaa taagacatgg gacagagaga ccagggactt gacagggaac ggaaaggacc       240
     tcaggatgac cctggctcat atcaaggacc agaaagaagg tgagagtcgg caggggcaag       300
     agtgactgga gaggcctttt ccagaaaagt taggggcaga gagcagggac ctgtatctac       360
     ccactggatc tggctcaggc tgggggtgag gaatgggggt cagtggaact cagcagggag       420
     gtgagccggc actcagccca cacagggagg catggaggag ggccagggag gcgtaccccc       480
     tgggctgagt tcctcacttg ggtggaaagg tgatgggttc gggaatggag aagtcactgc       540
     tgggtggggg caggcttgca ttccctccag gagattaggg tctgtgagat ccatgaagac       600
     aacagcacca ggagctccca gcatttctac tacgataggg agctcttcct ctcccaaaac       660
     ctggagactg aggaatggac aatgccccag tcctccagag ctcagacctt ggccatgaac       720
     gtcaggaatt tcttgaagga agatgccatg aagaccaaga cacactatca cgctatgcat       780
     gcagactgcc tgcaggaact acggcgatat ctaaaatccg gcgtagtcct gaggagaaca       840
     ggtaccgacg ctggccaggg gctctnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnctggc tctgcccttt cttctccagt gccccccatg gtgaatgtca cccgcagcga      1020
     ggcctcagag ggcaacatta ccgtgacatg cagggcttct ggcttctatc cctggaatat      1080
     cacactgagc tggcgtcagg atggggtatc tttgagccac gacacccagc agtgggggga      1140
     tgtcctgcct gatgggaatg gaacctacca gacctgggtg gccaccagga tttgccaagg      1200
     agaggagcag aggttcacct gctacatgga acacagcggg aatcacagca ctcaccctgt      1260
     gccctctgtg agcctagggt gaccctggag agggtcagac cagggtaggg acagcaggga      1320
     tggctgtggc tctctgccca gtgtataaca agtccctttt ttttcaggga aagtgctggt      1380
     gcttcagagt cattggcaga cattccatgt ttctgctgtt gctgctgctg ctgctgctgc      1440
     tgctgctatt tttgttatta ttattttcta cgtctgttgt tgtaagaaga aaacatcagc      1500
     tgcagagggt ccaggtgaga aaannnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1560
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1620
     nnnccagtgg agcatttacc cgtttccctc ttttctccag agctcgtgag cctgcaggtc      1680
     ctggatcaac acccagttgg gacgagtgac cacagggatg ccacacagct cggatttcag      1740
     cctctgatgt cagatcttgg gtccactggc tccactgagg gcgcctagac tctacagcca      1800
     ggcagctggg attcaattcc ctgcctggat ctcacgag                              1838
//


spacer
spacer