spacer

EBI Dbfetch

ID   AH010819; SV 2; linear; genomic DNA; STD; HUM; 2399 BP.
XX
AC   AH010819; AF264735-AF264737;
XX
DT   30-JUN-2011 (Rel. 109, Created)
DT   30-JUN-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I chain-related protein A (MICA) gene, MICA*017
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2399
RX   DOI; 10.1034/j.1399-0039.2001.057006520.x.
RX   PUBMED; 11556982.
RA   Obuchi N., Takahashi M., Nouchi T., Satoh M., Arimura T., Ueda K., Akai J.,
RA   Ota M., Naruse T., Inoko H., Numano F., Kimura A.;
RT   "Identification of MICA alleles with a long Leu-repeat in the transmembrane
RT   region and no cytoplasmic tail due to a frameshift-deletion in exon 4";
RL   Tissue Antigens 57(6):520-535(2001).
XX
RN   [2]
RP   1-2399
RA   Obuchi N., Kimura A.;
RT   ;
RL   Submitted (08-MAY-2000) to the INSDC.
RL   Molecular Pathology, Medical Research Institute, Tokyo Medical and Dental
RL   University, 2-3-10 Kanda-Surugadai, Chiyoda-Ku, Tokyo 101-0062, Japan
XX
DR   MD5; 5a7ae0f02766070f6306173b83b39028.
DR   Ensembl-Gn; ENSG00000183214; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235233; homo_sapiens.
DR   Ensembl-Tr; ENST00000400325; homo_sapiens.
DR   Ensembl-Tr; ENST00000418465; homo_sapiens.
DR   Ensembl-Tr; ENST00000547609; homo_sapiens.
DR   IMGT/LIGM; AH010819.
XX
CC   On or before Jun 29, 2011 this sequence version replaced
CC   gi:14279216, gi:14279217, gi:14279218, gi:14279215.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2399
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="DBB"
FT                   /cell_type="B-lymphoblastoid"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2399
FT                   /gene="MICA"
FT                   /allele="MICA*017"
FT   mRNA            join(<25..279,554..841,1553..1830,1931..2077,2222..>2399)
FT                   /gene="MICA"
FT                   /allele="MICA*017"
FT                   /product="MHC class I chain-related protein A"
FT   CDS             join(<25..279,554..841,1553..1830,1931..2077,2222..2230)
FT                   /codon_start=3
FT                   /gene="MICA"
FT                   /allele="MICA*017"
FT                   /product="MHC class I chain-related protein A"
FT                   /db_xref="GOA:Q29983"
FT                   /db_xref="HGNC:HGNC:7090"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1B3J"
FT                   /db_xref="PDB:1HYR"
FT                   /protein_id="AAK58536.1"
FT                   /translation="PHSLRYNLTVLSGDGSVQSGFLAEVHLDGQPFLRCDRQKCRAKPQ
FT                   GQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLREIRVCEIHEDNSTR
FT                   SSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADC
FT                   LQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSL
FT                   SHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKCWCFRV
FT                   IGRHSMFLLLLLLLLLLLLFLLLLFSTSVVVRRKHQLQRVQSS"
FT   exon            25..279
FT                   /gene="MICA"
FT                   /allele="MICA*017"
FT                   /number=2
FT   exon            554..841
FT                   /gene="MICA"
FT                   /allele="MICA*017"
FT                   /number=3
FT   gap             1429..1528
FT                   /estimated_length=unknown
FT   exon            1553..1830
FT                   /gene="MICA"
FT                   /allele="MICA*017"
FT                   /number=4
FT   exon            1931..2077
FT                   /gene="MICA"
FT                   /allele="MICA*017"
FT                   /number=5
FT   gap             2087..2186
FT                   /estimated_length=unknown
FT   exon            2222..>2399
FT                   /gene="MICA"
FT                   /allele="MICA*017"
FT                   /number=6
FT   3'UTR           2231..>2399
FT                   /gene="MICA"
FT                   /allele="MICA*017"
XX
SQ   Sequence 2399 BP; 489 A; 594 C; 648 G; 466 T; 202 other;
     cacctgtgat ttcctcttcc ccagagcccc acagtcttcg ttataacctc acggtgctgt        60
     ccggggatgg atctgtgcag tcagggtttc tcgctgaggt acatctggat ggtcagccct       120
     tcctgcgctg tgacaggcag aaatgcaggg caaagcccca gggacagtgg gcagaagatg       180
     tcctgggaaa taagacatgg gacagagaga ccagggactt gacagggaac ggaaaggacc       240
     tcaggatgac cctggctcat atcaaggacc agaaagaagg tgagagtcgg caggggcaag       300
     agtgactgga gaggcctttt ccagaaaagt taggggcaga gagcagggac ctgtatctac       360
     ccactggatc tggctcaggc tgggggtgag gaatgggggt cagtggaact cagcagggag       420
     ntgagccggc actcagccca cacagggagg catggaggag ggccagggag gcgtaccccc       480
     tgggctgagt tcctcanttg ggtggaaagg tgatgggttc gggaatggag aagtcactgc       540
     tgggtggggg caggcttgca ttccctccgg gagattaggg tctgtgagat ccatgaagac       600
     aacagcacca ggagctccca gcatttctac tacgatgggg agctcttcct ctcccaaaac       660
     ctggagactg aggaatggac aatgccccag tcctccagag ctcagacctt ggccatgaac       720
     gtcaggaatt tcttgaagga agatgccatg aagaccaaga cacactatca cgctatgcat       780
     gcagactgcc tgcaggaact acggcgatat ctaaaatccg gcgtagtcct gaggagaaca       840
     ggtaccgacg ctggccaggg gctctcctct ccctccaatt ctgctagagt tgcctcacct       900
     cccagatgtg tccagggaaa ccctccctgt gctatggatg aaggcatttc ctgttggcac       960
     atcgtgtcct gattttcctc tattgttaga gccactggat aaagacagtg ggtcagggac      1020
     tggaccatcc agtgttgtaa tcagggcaag tagaggaccc tccgacagaa tcctgagcct      1080
     ggggtgggtg tcaggcagga gaggaaggct tcagggccag ggctgccccc tctgcctccc      1140
     agcctgccca tcctggagag ttccctcctg gccccacaac ccaggagtcc acccctgaca      1200
     tccccctcct cagcatcaat gtggggatcc cagagcctga ggccacagtc ccatggccca      1260
     tcctcctgcc agcctggaag aactgggccc cagagtgagg acagacttgc aggtcagggg      1320
     tcccagaggg cttcagccag agtgagaaca gtgaagagaa acagccctgt tcctctcccc      1380
     tccttagagg ggagcagggc ttcactggct ctgccctttc ttctccagnn nnnnnnnnnn      1440
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1500
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnct ggctctgccc tttcttctcc agtgcccccc      1560
     atggtgaatg tcacccgcag cgaggcctca gagggcaaca ttaccgtgac atgcagggct      1620
     tctggcttct atccctggaa tatcacactg agctggcgtc aggatggggt atctttgagc      1680
     cacgacaccc agcagtgggg ggatgtcctg cctgatggga atggaaccta ccagacctgg      1740
     gtggccacca ggatttgcca aggagaggag cagaggttca cctgctacat ggaacacagc      1800
     gggaatcaca gcactcaccc tgtgccctct gtgagcctag ggtgaccctg gagagggtca      1860
     gaccagggta gggacagcag ggatggctgt ggctctctgc ccagtgtata acaagtccct      1920
     tttttttcag ggaaagtgct ggtgcttcag agtcattggc agacattcca tgtttctgct      1980
     gttgctgctg ctgctgctgc tgctgctgct atttttgtta ttattatttt ctacgtctgt      2040
     tgttgtaaga agaaaacatc agctgcagag ggtccaggtg agaaaannnn nnnnnnnnnn      2100
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2160
     nnnnnnnnnn nnnnnnnnnn nnnnnnagtg gagcatttac ccgtttccct cttttctcca      2220
     gagctcgtga gcctgcaggt cctggatcaa cacccagttg ggacgagtga ccacagggat      2280
     gccacacagc tcggatttca gcctctgatg tcagatcttg ggtccactgg ctccactgag      2340
     ggcgcctaga ctctacagcc aggcagctgg gattcaattc cctgcctgga tctcacgag       2399
//


spacer
spacer