spacer

EBI Dbfetch

ID   AF243536; SV 1; linear; genomic DNA; STD; HUM; 258 BP.
XX
AC   AF243536;
XX
DT   17-AUG-2000 (Rel. 64, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*15 new allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-258
RA   Hurley C.K., Tang T.F., Lin Y.;
RT   "Human Leukocyte Antigen Class II DRB1*15 new";
RL   Unpublished.
XX
RN   [2]
RP   1-258
RA   Hurley C.K., Tang T.F., Lin Y.;
RT   ;
RL   Submitted (10-MAR-2000) to the INSDC.
RL   Microbiology, Georgetown University, 3970 Reservoir Rd. NW, Washington, DC
RL   20007, USA
XX
DR   MD5; 1336af3fa8a08de7a0f28f34e1f2b529.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..258
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="DRB1*1303, 15 new, DRB3*0101, DRB5*01011"
FT                   /db_xref="taxon:9606"
FT   exon            1..258
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   mRNA            <1..>258
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>258
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q9GJG1"
FT                   /db_xref="IMGT/HLA:DRB1*15:10"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9GJG1"
FT                   /protein_id="AAG00413.1"
FT                   /translation="RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDILEDERAAVDTYCRHNYGVVESFT"
XX
SQ   Sequence 258 BP; 55 A; 62 C; 94 G; 47 T; 0 other;
     cacgtttcct gtggcagcct aagagggagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccagg aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgacgc tgagtactgg aacagccaga       180
     aggacatcct ggaagacgag cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacag                                                     258
//


spacer
spacer