spacer

EBI Dbfetch

ID   AF239244; SV 1; linear; genomic DNA; STD; HUM; 267 BP.
XX
AC   AF239244;
XX
DT   27-MAR-2000 (Rel. 63, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*TT68 allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-267
RA   Holdsworth R., Bowman S., Diviney M., Oliver D., Chapman G., Kennedy A.,
RA   Greville W., Dunckley H.;
RT   "HLA-DRB1 allele with codon deletion in exon 2";
RL   Unpublished.
XX
RN   [2]
RP   1-267
RA   Holdsworth R., Bowman S., Diviney M., Oliver D., Chapman G., Kennedy A.,
RA   Greville W., Dunckley H.;
RT   ;
RL   Submitted (24-FEB-2000) to the INSDC.
RL   Tissue Typing Services, Australian Red Cross Blood Service, 153 Clarence
RL   Street, Sydney, NSW 2000, Australia
XX
DR   MD5; 7da1b99ee9d933378f525be296d1b29d.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..267
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>267
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   exon            1..267
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   CDS             <1..>267
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q9MYD9"
FT                   /db_xref="IMGT/HLA:DRB1*15:13"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9MYD9"
FT                   /protein_id="AAF59946.1"
FT                   /translation="RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQDILEQARAAVDTYCRHNYGVVESFTVQRR"
FT   variation       177^178
FT                   /gene="HLA-DRB1"
FT                   /replace="aga"
FT                   /note="compared to wild-type HLA-DRB1"
XX
SQ   Sequence 267 BP; 53 A; 66 C; 100 G; 48 T; 0 other;
     cacgtttcct gtggcagcct aagagggagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccagg aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgacgc tgagtactgg aacagccagg       180
     acatcctgga gcaggcgcgg gccgcggtgg acacctactg cagacacaac tacggggttg       240
     tggagagctt cacagtgcag cggcgag                                           267
//


spacer
spacer