Dbfetch

ID   AF234175; SV 1; linear; genomic DNA; STD; HUM; 249 BP.
XX
AC   AF234175;
XX
DT   18-JAN-2001 (Rel. 66, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*1112 allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-249
RX   DOI; 10.1034/j.1399-0039.2001.057001085.x.
RX   PUBMED; 11169266.
RA   Luo M., Blanchard J., Maclean I., Brunham R.;
RT   "Identification of a novel DRB1 allele, DRB1*1112, by sequence-based DRB
RT   typing";
RL   Tissue Antigens 57(1):85-86(2001).
XX
RN   [2]
RP   1-249
RA   Luo M., Blanchard J., Maclean I., Brunham R.;
RT   ;
RL   Submitted (14-FEB-2000) to the INSDC.
RL   Medical Microbiology, University of Manitoba, 730 William Ave., Winnipeg,
RL   Manitoba R3E 0W3, Canada
XX
DR   MD5; 5610702405e189589ccecf21e0b49d96.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..249
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            1..249
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   mRNA            <1..>249
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>249
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q9BD47"
FT                   /db_xref="IMGT/HLA:DRB1*11:12:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9BD47"
FT                   /protein_id="AAG50193.1"
FT                   /translation="LEYSTSECHFFNGTERVRFLDRYFYNQEEFVRFDSDVGEFRAVTE
FT                   LGRPDEEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFT"
XX
SQ   Sequence 249 BP; 54 A; 56 C; 89 G; 50 T; 0 other;
     ttggagtact ctacgtctga gtgtcatttc ttcaatggga cggagcgggt gcggttcctg        60
     gacagatact tctataacca agaggagttc gtgcgcttcg acagcgacgt gggggagttc       120
     cgggcggtga cggagctggg gcggcctgat gaggagtact ggaacagcca gaaggacttc       180
     ctggaagaca ggcgggccgc ggtggacacc tactgcagac acaactacgg ggttggtgag       240
     agcttcaca                                                               249
//