spacer

EBI Dbfetch

ID   AF217961; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AF217961;
XX
DT   15-FEB-2000 (Rel. 62, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*13022 allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1034/j.1399-0039.2000.560217.x.
RX   PUBMED; 11019926.
RA   Martinetti M., Pizzochero C., Asti M., Salvaneschi L.;
RT   "New HLA-DRB1* nucleotide sequence of Italian origin: HLA-DRB1*13022";
RL   Tissue Antigens 56(2):192-193(2000).
XX
RN   [2]
RP   1-270
RA   Martinetti M., Asti M., Pizzochero C.;
RT   ;
RL   Submitted (20-DEC-1999) to the INSDC.
RL   Lab. HLA-Serv. Immunoematol. Trasf., IRCCS Policlinico S. Matteo, Piazzale
RL   Golgi 2, Pavia 27100, Italy
XX
DR   MD5; 94c12810506405223ce0591f02427d00.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /note="sequence confirmed through family study"
FT                   /db_xref="taxon:9606"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q9MYG3"
FT                   /db_xref="IMGT/HLA:DRB1*13:02:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9MYG3"
FT                   /protein_id="AAF32310.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFHNQEENVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDILEDERAAVDTYCRHNYGVGESFTVQRR"
XX
SQ   Sequence 270 BP; 58 A; 66 C; 96 G; 50 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacatcct ggaagacgag cgcgccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer