spacer

EBI Dbfetch

ID   AH008863; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AH008863; AF214111-AF214112;
XX
DT   20-JUL-2011 (Rel. 109, Created)
DT   20-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*0103 allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RX   DOI; 10.1016/S0198-8859(00)00238-X.
RX   PUBMED; 11182232.
RA   Poland G.A., Sohni Y.R., Domanico M., Kroning C.M., DeGoey S.R., Jimale M.,
RA   Jacobson R.M., Moore S.B.;
RT   "High frequency of HLA-A*0103 allele in a Somali population";
RL   Hum. Immunol. 62(2):197-200(2001).
XX
RN   [2]
RP   1-646
RA   Poland G.A., Sohni Y.R., Domanico M., Kroning C.M., DeGoey S.R., Jimale M.,
RA   Jacobson R.M., Moore S.B.;
RT   ;
RL   Submitted (09-DEC-1999) to the INSDC.
RL   Vaccine Research, Clinical Pharmacology Unit, Mayo Clinic and Foundation,
RL   200 First St. SW GU 605, Rochester, MN 55905, USA
XX
DR   Ensembl-Gn; ENSG00000224320; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229215; homo_sapiens.
DR   Ensembl-Gn; ENSG00000265434; homo_sapiens.
DR   Ensembl-Tr; ENST00000431930; homo_sapiens.
DR   Ensembl-Tr; ENST00000443552; homo_sapiens.
DR   Ensembl-Tr; ENST00000549869; homo_sapiens.
DR   Ensembl-Tr; ENST00000552193; homo_sapiens.
DR   Ensembl-Tr; ENST00000583265; homo_sapiens.
XX
CC   On or before Jul 19, 2011 this sequence version replaced
CC   gi:6626174, gi:6626175, gi:6626176.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0103"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0103"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0103"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:P30443"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1W72"
FT                   /db_xref="PDB:3BO8"
FT                   /db_xref="PDB:4NQV"
FT                   /db_xref="PDB:4NQX"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30443"
FT                   /protein_id="AAF19525.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKME
FT                   PRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQMMYGCDVGP
FT                   DGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRC
FT                   VDGLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0103"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0103"
FT                   /number=3
XX
SQ   Sequence 646 BP; 111 A; 164 C; 196 G; 75 T; 100 other;
     gctcccactc catgaggtat ttcttcacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagaa gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accaggagac acggaatatg aaggcccact cacagactga ccgagcgaac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gttctcacac catccagatg atgtatggct gcgacgtggg gccggacggg       420
     cgcttcctcc gcgggtaccg gcaggacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcttggac cgcggcggac atggcagctc agatcaccaa gcgcaagtgg       540
     gaggcggtcc atgcggcgga gcagcggaga gtctacctgg agggccggtg cgtggacggg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcacgg                      646
//


spacer
spacer