spacer

EBI Dbfetch

ID   AF211979; SV 1; linear; genomic DNA; STD; HUM; 531 BP.
XX
AC   AF211979;
XX
DT   15-FEB-2000 (Rel. 62, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DPB1) gene, HLA-DPB1 2701 variant
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-531
RX   DOI; 10.1034/j.1399-0039.2000.560313.x.
RX   PUBMED; 11034567.
RA   Rozemuller E.H., van der Zwan A.W., Voorter C.E.M., Tilanus M.G.J.;
RT   "DPB1*8501, a novel DPB1 variant in the US Black population";
RL   Tissue Antigens 56(3):282-284(2000).
XX
RN   [2]
RP   1-531
RA   Rozemuller E.H., Tilanus M.G.J.;
RT   ;
RL   Submitted (06-DEC-1999) to the INSDC.
RL   Pathology, University Medical Center, P.O.Box 85500, Utrecht 3508GA,
RL   Netherlands
XX
DR   MD5; f4ee0d02ae8f240476dd470df8202952.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..531
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /clone="UCLA212"
FT                   /cell_line="UCLA"
FT                   /db_xref="taxon:9606"
FT   exon            141..404
FT                   /gene="HLA-DPB1"
FT                   /number=2
FT   mRNA            <141..>404
FT                   /gene="HLA-DPB1"
FT                   /product="MHC class II antigen"
FT   CDS             <141..>404
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q9MYG7"
FT                   /db_xref="IMGT/HLA:DPB1*85:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9MYG7"
FT                   /protein_id="AAF32279.1"
FT                   /translation="NYVYQLRQECYAFNGTQRFLERYIYNREEYARFDSDVGEFRAVTE
FT                   LGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELDEAVTLQHR"
XX
SQ   Sequence 531 BP; 121 A; 127 C; 194 G; 89 T; 0 other;
     tcggtactag gaaaactcct attttaaaat ccagccctga gtgggaagat ttgggaagaa        60
     tcgttaatat tgagagagag agggagaaag aggattagat gagagtggcg cctccgctca       120
     tgtccgcccc ctccccgcag agaattacgt gtaccagtta cggcaggaat gctacgcgtt       180
     taatgggaca cagcgcttcc tggagagata catctacaac cgggaggagt acgcgcgctt       240
     cgacagcgac gtgggggagt tccgggcggt gacggagctg gggcggcctg ctgcggagta       300
     ctggaacagc cagaaggaca tcctggagga gaagcgggca gtgccggaca ggatgtgcag       360
     acacaactac gagctggacg aggccgtgac cctgcagcac cgaggtgagt gagggctttg       420
     ggccggcggt cccagggcag ccccgcgggc ccgtgcccag ggcgcaggag cagccgggtt       480
     ggcctaaggg accttagtgc cgggcggaaa ggggactttg ggttggggat t                531
//


spacer
spacer