spacer

EBI Dbfetch

ID   AF207709; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AF207709;
XX
DT   14-OCT-2000 (Rel. 65, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (DRB4) gene, DRB4*01033 allele, exon 2
DE   and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1034/j.1399-0039.2000.560312.x.
RX   PUBMED; 11034566.
RA   Palou E., Nogues N., Gil J., Ribera A.;
RT   "Identification of a new DRB4 allele";
RL   Tissue Antigens 56(3):279-281(2000).
XX
RN   [2]
RP   1-270
RA   Palou E., Nogues N., Gil J., Ribera A.;
RT   ;
RL   Submitted (22-NOV-1999) to the INSDC.
RL   Immunohematologia, Centre de Transfusions i Banc de Teixits, Pg. Vall
RL   d'Hebron, 119-129, Barcelona 08035, Spain
XX
DR   MD5; 664f64f5f7a352aa2d78b2fac794588f.
DR   Ensembl-Gn; ENSG00000227357; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231021; homo_sapiens.
DR   Ensembl-Tr; ENST00000411565; homo_sapiens.
DR   Ensembl-Tr; ENST00000411959; homo_sapiens.
DR   Ensembl-Tr; ENST00000457451; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>270
FT                   /gene="DRB4"
FT                   /product="MHC class II antigen"
FT   exon            1..270
FT                   /gene="DRB4"
FT                   /number=2
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="DRB4"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q9GJ49"
FT                   /db_xref="IMGT/HLA:DRB4*01:03:03"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9GJ49"
FT                   /protein_id="AAG22593.1"
FT                   /translation="RFLEQAKCECHFLNGTERVWNLIRYIYNQEEYARYNSDLGEYQAV
FT                   TELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRR"
XX
SQ   Sequence 270 BP; 65 A; 61 C; 96 G; 48 T; 0 other;
     cacgtttctt ggagcaggct aagtgtgagt gtcatttcct caatgggacg gagcgagtgt        60
     ggaacctgat cagatacatc tataaccaag aggagtacgc gcgctacaac agtgacctgg       120
     gggagtacca ggcggtgacg gagctggggc ggcctgacgc tgagtactgg aacagccaga       180
     aggacctcct ggagcggagg cgggccgagg tggacaccta ttgcagatac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer