spacer

EBI Dbfetch

ID   AH008760; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AH008760; AF206514-AF206515;
XX
DT   20-JUL-2011 (Rel. 109, Created)
DT   20-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen HLA-B heavy chain (HLA-B15) gene, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RX   DOI; 10.1034/j.1399-0039.2000.560512.x.
RX   PUBMED; 11144297.
RA   Magira E., Beznik-Cizman B., Monos D.;
RT   "HLA-B*1559: a hybrid allele including exon 2 of HLA-B35 and exon 3 of
RT   HLA-B15 and serologically typed as B35";
RL   Tissue Antigens 56(5):460-462(2000).
XX
RN   [2]
RP   1-646
RA   Magira E.E., Monos D.S.;
RT   ;
RL   Submitted (18-NOV-1999) to the INSDC.
RL   Pediatrics, U. Penn. CHOP, 34th and Civic Center blvd., Philadelphia, PA
RL   19104, USA
XX
CC   On or before Jul 19, 2011 this sequence version replaced
CC   gi:6561854, gi:6561855, gi:6561856.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-B15"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-B15"
FT                   /product="MHC class I antigen HLA-B heavy chain"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-B15"
FT                   /product="MHC class I antigen HLA-B heavy chain"
FT                   /db_xref="GOA:Q9TP27"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q9TP27"
FT                   /protein_id="AAF17097.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQWRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B15"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-B15"
FT                   /number=3
XX
SQ   Sequence 646 BP; 114 A; 172 C; 190 G; 70 T; 100 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagg atgtacggct gcgacgtggg gccggacggg       420
     cgcctcctcc gcgggcataa ccagtacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctga gctcctggac cgcggcggac acggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagtggaga gcctacctgg agggcctgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//


spacer
spacer