Dbfetch

ID   AF196489; SV 1; linear; mRNA; STD; HUM; 1197 BP.
XX
AC   AF196489;
XX
DT   12-JUL-2002 (Rel. 72, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-C) mRNA, HLA-C-Cw*0409 N allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1197
RX   DOI; 10.1034/j.1399-0039.2002.590204.x.
RX   PUBMED; 12028535.
RA   Balas A., Santos S., Aviles M.J., Garcia-Sanchez F., Lillo R., Alvarez A.,
RA   Villar-Guimerans L.M., Vicario J.L.;
RT   "Elongation of the cytoplasmic domain, due to a point deletion at exon 7,
RT   results in an HLA-C null allele, Cw*0409 N";
RL   Tissue Antigens 59(2):95-100(2002).
XX
RN   [2]
RP   1-1197
RA   Santos S., Balas A., Vicario J.L.;
RT   ;
RL   Submitted (20-OCT-1999) to the INSDC.
RL   Histocompatibility, Regional Transfusion Center from Madrid, Avda. Menendez
RL   Pelayo 65, Madrid 28009, Spain
XX
DR   MD5; 7193c0b1fa71f17bd952bb949fd76a30.
DR   H-InvDB; HIT000073678_03.4.
DR   H-InvDB; HIT000073678_04.4.
DR   H-InvDB; HIT000073678_05.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1197
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="mRNA"
FT                   /note="peripheral blood lymphocyte"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1197
FT                   /codon_start=1
FT                   /gene="HLA-C"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q95HN1"
FT                   /db_xref="H-InvDB:HIT000073678_02.4"
FT                   /db_xref="IMGT/HLA:C*04:09N"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q95HN1"
FT                   /protein_id="AAM76870.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWAGSHSMRYFSTSVSWPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPREPWVEQEGPEYWDRETQKYKRQAQADRVNLRK
FT                   LRGYYNQSEDGSHTLQRMFGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQRRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQWDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWKPSSQPTIPIVGIVAGLAVLAVLAVLGAMVAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKPETAACVGLRCRISSHLSFVTSRASGISFCKGI"
XX
SQ   Sequence 1197 BP; 236 A; 357 C; 398 G; 206 T; 0 other;
     atgcgggtca tggcgccccg aaccctcatc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg ccggctccca ctccatgagg tatttctcca catccgtgtc ctggcccggc       120
     cgcggggagc cccgcttcat cgcagtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagtcc aagaggggag ccgcgggagc cgtgggtgga gcaggagggg       240
     ccggagtatt gggaccggga gacacagaag tacaagcgcc aggcacaggc tgaccgagtg       300
     aacctgcgga aactgcgcgg ctactacaac cagagcgagg acgggtctca caccctccag       360
     aggatgtttg gctgcgacct ggggccggac gggcgcctcc tccgcgggta taaccagttc       420
     gcctacgacg gcaaggatta catcgccctg aacgaggatc tgcgctcctg gaccgccgcg       480
     gacacggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgaggc ggagcagcgg       540
     agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcgcgga acacccaaag acacacgtga cccaccatcc cgtctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagtggg atggggagga ccaaactcag gacaccgagc ttgtggagac caggccagca       780
     ggagatggaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacgtgcc atgttcagca cgaggggctg ccggagcccc tcaccctgag atggaagccg       900
     tcttcccagc ccaccatccc catcgtgggc atcgttgctg gcctggctgt cctggctgtc       960
     ctagctgtcc taggagctat ggtggctgtt gtgatgtgta ggaggaagag ctcaggtgga      1020
     aaaggaggga gctgctctca ggctgcgtcc agcaacagtg cccagggctc tgatgagtct      1080
     ctcatcgctt gtaagcctga gacagctgcc tgtgtgggac tgagatgcag gatttcttca      1140
     cacctctcct ttgtgacttc aagagcctct ggcatctctt tctgcaaagg catctga         1197
//