spacer

EBI Dbfetch

ID   AF196184; SV 1; linear; genomic DNA; STD; HUM; 920 BP.
XX
AC   AF196184;
XX
DT   14-JUL-2004 (Rel. 80, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*5801 allele, exons 2
DE   and 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-920
RX   DOI; 10.1007/s00251-004-0646-5.
RX   PUBMED; 14985876.
RA   Martinez-Laso J., Moscoso J., Zamora J., Martin-Villa M., Lowy E.,
RA   Vargas-Alarcon G., Serrano-Vela J.I., Gomez-Casado E., Arnaiz-Villena A.;
RT   "Different evolutionary pathway of B*570101 and B*5801 (B17 group) alleles
RT   based in intron sequences";
RL   Immunogenetics 55(12):866-872(2004).
XX
RN   [2]
RP   1-920
RA   Arnaiz-Villena A., Martinez-Laso J., Gomez-Casado E.;
RT   ;
RL   Submitted (19-OCT-1999) to the INSDC.
RL   Immunology and Molecular Biology, Hospital 12 de Octubre, Carretera de
RL   Andalucia, Madrid 28041, Spain
XX
DR   MD5; 5487c20812970e291d96ce5638e2964f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..920
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>920
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5801"
FT   mRNA            join(<130..399,645..>920)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5801"
FT                   /product="MHC class I antigen"
FT   CDS             join(<130..399,645..>920)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5801"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q6EZG0"
FT                   /db_xref="IMGT/HLA:B*58:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q6EZG0"
FT                   /protein_id="AAQ13834.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQRMYGCDLGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            130..399
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5801"
FT                   /number=2
FT   exon            645..920
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5801"
FT                   /number=3
XX
SQ   Sequence 920 BP; 155 A; 299 C; 348 G; 118 T; 0 other;
     gtgagtgcgg ggtcgggagg gaaatggcct ctgtggggag gagcgagggg accgcaggcg        60
     ggggcgcagg acctgaggag ccgcgccggg aggagggtcg ggcgggtctc agcccctcct       120
     cgcccccagg ctcccactcc atgaggtatt tctacaccgc catgtcccgg cccggccgcg       180
     gggagccccg cttcatcgca gtgggctacg tggacgacac ccagttcgtg aggttcgaca       240
     gcgacgccgc gagtccgagg acggagcccc gggcgccatg gatagagcag gaggggccgg       300
     agtattggga cggggagaca cggaacatga aggcctccgc gcagacttac cgagagaacc       360
     tgcggatcgc gctccgctac tacaaccaga gcgaggccgg tgagtgaccc cggcccgggg       420
     cgcaggtcac gactccccat cccccacgta cggcccgggt cgccccgagt ctccgggtcc       480
     gagatccgcc tccctgaggc cgcgggaccc gcccagaccc tcgaccggcg agagccccag       540
     gcgcgtttac ccggtttcat tttcagttga ggccaaaatc cccgcgggtt ggtcggggcg       600
     gggcggggct cgggggacgg ggctgaccgc ggggccgggg ccagggtctc acatcatcca       660
     gaggatgtat ggctgcgacc tggggcccga cgggcgcctc ctccgcgggc atgaccagtc       720
     cgcctacgac ggcaaggatt acatcgccct gaacgaggac ctgagctcct ggaccgcggc       780
     ggacaccgcg gctcagatca cccagcgcaa gtgggaggcg gcccgtgtgg cggagcagct       840
     gagagcctac ctggagggcc tgtgcgtgga gtggctccgc agatacctgg agaacgggaa       900
     ggagacgctg cagcgcgcgg                                                   920
//


spacer
spacer