spacer

EBI Dbfetch

ID   AF196183; SV 1; linear; genomic DNA; STD; HUM; 920 BP.
XX
AC   AF196183;
XX
DT   14-JUL-2004 (Rel. 80, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*5701 allele, exons 2
DE   and 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-920
RX   DOI; 10.1007/s00251-004-0646-5.
RX   PUBMED; 14985876.
RA   Martinez-Laso J., Moscoso J., Zamora J., Martin-Villa M., Lowy E.,
RA   Vargas-Alarcon G., Serrano-Vela J.I., Gomez-Casado E., Arnaiz-Villena A.;
RT   "Different evolutionary pathway of B*570101 and B*5801 (B17 group) alleles
RT   based in intron sequences";
RL   Immunogenetics 55(12):866-872(2004).
XX
RN   [2]
RP   1-920
RA   Arnaiz-Villena A., Martinez-Laso J., Gomez-Casado E.;
RT   ;
RL   Submitted (19-OCT-1999) to the INSDC.
RL   Immunology and Molecular Biology, Hospital 12 de Octubre, Carretera de
RL   Andalucia, Madrid 28041, Spain
XX
DR   MD5; 3efd5600116f47602a4b4e2d345203c5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..920
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>920
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5701"
FT   mRNA            join(<129..398,645..>920)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5701"
FT                   /product="MHC class I antigen"
FT   CDS             join(<129..398,645..>920)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5701"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q6EZG1"
FT                   /db_xref="IMGT/HLA:B*57:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q6EZG1"
FT                   /protein_id="AAQ13833.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMA
FT                   PRAPWIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQVMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            129..398
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5701"
FT                   /number=2
FT   exon            645..920
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5701"
FT                   /number=3
XX
SQ   Sequence 920 BP; 156 A; 299 C; 347 G; 118 T; 0 other;
     gtgagtgcgg gtcggcaggg aaatggcctc tgtagggagg agcaagggga ccgcaggcgg        60
     gggcgcagga cccggggagc cgcgccggga ggagggtcgg gcgggtctca gcccctcctc       120
     gcccccaggc tcccactcca tgaggtattt ctacaccgcc atgtcccggc ccggccgcgg       180
     ggagccccgc ttcatcgcag tgggctacgt ggacgacacc cagttcgtga ggttcgacag       240
     cgacgccgcg agtccgagga tggcgccccg ggcgccatgg atagagcagg aggggccgga       300
     gtattgggac ggggagacac ggaacatgaa ggcctccgcg cagacttacc gagagaacct       360
     gcggatcgcg ctccgctact acaaccagag cgaggccggt gagtgacccc ggcccggggc       420
     gcaggtcacg actccccatc ccccacgtac ggcccgggtc gccccgagtc tccgggtccg       480
     agatccaccc ccctgaggcc gcgggacccg cccagaccct cgaccggcga gagccccagg       540
     cgcgtttacc cggtttcatt ttcagttgag gccaaaatcc ccgcgggttg gtcagggcgg       600
     ggcggggctc ggggggacgg ggctgaccgc ggggccgggg ccagggtctc acatcatcca       660
     ggtgatgtat ggctgcgacg tggggccgga cgggcgcctc ctccgcgggc atgaccagtc       720
     cgcctacgac ggcaaggatt acatcgccct gaacgaggac ctgagctcct ggaccgcggc       780
     ggacacggcg gctcagatca cccagcgcaa gtgggaggcg gcccgtgtgg cggagcagct       840
     gagagcctac ctggagggcc tgtgcgtgga gtggctccgc agatacctgg agaacgggaa       900
     ggagacgctg cagcgcgcgg                                                   920
//


spacer
spacer