spacer

EBI Dbfetch

ID   AF196182; SV 1; linear; genomic DNA; STD; HUM; 920 BP.
XX
AC   AF196182;
XX
DT   14-JUL-2004 (Rel. 80, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*1302 allele, exons 2
DE   and 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-920
RX   DOI; 10.1007/s00251-004-0646-5.
RX   PUBMED; 14985876.
RA   Martinez-Laso J., Moscoso J., Zamora J., Martin-Villa M., Lowy E.,
RA   Vargas-Alarcon G., Serrano-Vela J.I., Gomez-Casado E., Arnaiz-Villena A.;
RT   "Different evolutionary pathway of B*570101 and B*5801 (B17 group) alleles
RT   based in intron sequences";
RL   Immunogenetics 55(12):866-872(2004).
XX
RN   [2]
RP   1-920
RA   Arnaiz-Villena A., Martinez-Laso J., Gomez-Casado E.;
RT   ;
RL   Submitted (19-OCT-1999) to the INSDC.
RL   Immunology and Molecular Biology, Hospital 12 de Octubre, Carretera de
RL   Andalucia, Madrid 28041, Spain
XX
DR   MD5; a78f5af0adb460a2c59f82d1fc503d0c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..920
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>920
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1302"
FT   mRNA            join(<130..399,645..>920)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1302"
FT                   /product="MHC class I antigen"
FT   CDS             join(<130..399,645..>920)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1302"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q6EZG2"
FT                   /db_xref="IMGT/HLA:B*13:02:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q6EZG2"
FT                   /protein_id="AAQ13832.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFITVGYVDDTQFVRFDSDATSPRMA
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHTWQTMYGCDLGP
FT                   DGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTAAQITQLKWEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            130..399
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1302"
FT                   /number=2
FT   exon            645..920
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1302"
FT                   /number=3
XX
SQ   Sequence 920 BP; 161 A; 299 C; 342 G; 118 T; 0 other;
     gtgagtgcgg gatcgggagg gaaatggcct ctgtggggag gagcgagggg accgcaggcg        60
     ggggcgcagg acccggggag ccgcgccggg aggagggtct ggcgggtctc agcccctcct       120
     ggcccccagg ctcccactcc atgaggtatt tctacaccgc catgtcccgg cccggccgcg       180
     gggagccccg cttcatcacc gtgggctacg tggacgacac ccagttcgtg aggttcgaca       240
     gcgacgccac gagtccgagg atggcgcccc gggcgccatg gatagagcag gaggggccgg       300
     agtattggga ccgggagaca cagatctcca agaccaacac acagacttac cgagagaacc       360
     tgcgcaccgc gctccgctac tacaaccaga gcgaggccgg tgagtgaccc cggcccgggg       420
     cgcaggtcac gactccccat cccccacgga cgggccgggt cgccccgagt ctccgggtcc       480
     gagatccgcc tccctgaggc cgcgggaccc gcccagaccc tcgaccggcg agagccccag       540
     gcgcgtttac ccggtttcat tttcagttga ggccaaaatc cccgcgggtt ggtcggggcg       600
     gggcggggct cgggggacgg ggctgaccgc ggggccgggg ccagggtctc acacttggca       660
     gacgatgtat ggctgcgacc tggggccgga cgggcgcctc ctccgcgggc ataaccagtt       720
     agcctacgac ggcaaggatt acatcgccct gaacgaggac ctgagctcct ggaccgcggc       780
     ggacaccgcg gctcagatca cccagctcaa gtgggaggcg gcccgtgtgg cggagcagct       840
     gagagcctac ctggagggcg agtgcgtgga gtggctccgc agatacctgg agaacgggaa       900
     ggagacgctg cagcgcgcgg                                                   920
//


spacer
spacer