Dbfetch

ID   AF195786; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AF195786;
XX
DT   26-NOV-1999 (Rel. 61, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*JSMA allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1046/j.1365-2370.2001.00243.x.
RX   PUBMED; 11532019.
RA   Trejaut J., Kennedy A., Hobart D., Le T., Greville W.D., Ng G.,
RA   Taverniti A., Dunckley H.;
RT   "PCR-RFLP typing detects new HLA-DRB1 alleles: DRB1*13022, DRB1*1336 and
RT   DRB1*1435";
RL   Eur. J. Immunogenet. 28(4):441-447(2001).
XX
RN   [2]
RP   1-270
RA   Greville W.D., Ng G., Kennedy A., Le T., Trejaut J.A., Dunckley H.;
RT   ;
RL   Submitted (18-OCT-1999) to the INSDC.
RL   Tissue Typing, Molecular Genetics Laboratory, Australian Red Cross Blood
RL   Service, 153 Clarence Street, Sydney, NSW 2000, Australia
XX
DR   MD5; 64fb2015612a15a844155a8abcc829a1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="BM1-131930"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q9TP92"
FT                   /db_xref="IMGT/HLA:DRB1*13:36"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9TP92"
FT                   /protein_id="AAF13227.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFHNQEENVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDILEDERAAVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /number=2
XX
SQ   Sequence 270 BP; 59 A; 65 C; 97 G; 49 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacatcct ggaagacgag cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//