spacer

EBI Dbfetch

ID   AF191104; SV 1; linear; genomic DNA; STD; HUM; 248 BP.
XX
AC   AF191104;
XX
DT   19-OCT-1999 (Rel. 61, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1 variant allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-248
RA   Wu J., McAuley J., Endres R., Kelly C., Williams T.;
RT   "Novel HLA-DRB1 allele identified in potential bone marrow donor and
RT   recipient";
RL   Unpublished.
XX
RN   [2]
RP   1-248
RA   Wu J., McAuley J., Endres R., Kelly C., Williams T.;
RT   ;
RL   Submitted (30-SEP-1999) to the INSDC.
RL   Pathology, University of New Mexico, 915 Camino De Salud, Albuquerque, NM
RL   87131, USA
XX
DR   MD5; 0b36616fab1616eb1ed34f9c268d4450.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..248
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p23"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>248
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>248
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q9TP93"
FT                   /db_xref="IMGT/HLA:DRB1*15:10"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9TP93"
FT                   /protein_id="AAF03162.1"
FT                   /translation="FLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVT
FT                   ELGRPDAEYWNSQKDILEDERAAVDTYCRHNYGVVES"
XX
SQ   Sequence 248 BP; 52 A; 58 C; 93 G; 45 T; 0 other;
     gtttcctgtg gcagcctaag agggagtgtc atttcttcaa tgggacggag cgggtgcggt        60
     tcctggacag atacttctat aaccaggagg agtccgtgcg cttcgacagc gacgtggggg       120
     agttccgggc ggtgacggag ctggggcggc ctgacgctga gtactggaac agccagaagg       180
     acatcctgga agacgagcgg gccgcggtgg acacctactg cagacacaac tacggggttg       240
     tggagagc                                                                248
//


spacer
spacer