spacer

EBI Dbfetch

ID   AF190447; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AF190447;
XX
DT   02-OCT-2000 (Rel. 65, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*4402 variant allele,
DE   exon 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Turner S., Turner M., Hildebrand W.H.;
RT   "Molecular characterization of HLA-B*4402 variant";
RL   Unpublished.
XX
RN   [2]
RP   1-276
RA   Turner S., Turner M., Hildebrand W.H.;
RT   ;
RL   Submitted (27-SEP-1999) to the INSDC.
RL   Medicine, Univ. of OK Health Sciences Center, P.O. Box 26901, Oklahoma
RL   City, OK 73104, USA
XX
DR   MD5; d0bb3f339eb2aba72ae75d42fa4cf899.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="all061"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(AF190446.1:<1..270,1..>276)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT   CDS             join(AF190446.1:<1..270,1..>276)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q9GJ50"
FT                   /db_xref="IMGT/HLA:B*44:16"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q9GJ50"
FT                   /protein_id="AAG17140.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYGCDVGP
FT                   DGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQDRAYLEGEC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..276
FT                   /gene="HLA-B"
FT                   /number=3
XX
SQ   Sequence 276 BP; 55 A; 82 C; 105 G; 34 T; 0 other;
     ggtctcacat catccagagg atgtacggct gcgacgtggg gccggacggg cgcctcctcc        60
     gcgggtatga ccaggacgcc tacgacggca aggattacat cgccctgaac gaggacctga       120
     gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     gtgtggcgga gcaggacaga gcctacctgg agggcgagtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcgcgg                                 276
//


spacer
spacer