spacer

EBI Dbfetch

ID   AH008467; SV 2; linear; genomic DNA; STD; HUM; 819 BP.
XX
AC   AH008467; AF190278-AF190280;
XX
DT   20-JUL-2011 (Rel. 109, Created)
DT   20-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*1530 variant allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-819
RX   DOI; 10.1034/j.1399-0039.2002.600210.x.
RX   PUBMED; 12392514.
RA   Williams T.M., Wu J., Bassinger S., Feldman D., Birkos S., Kearns J.,
RA   Kamoun M.;
RT   "New HLA-B alleles identified and sequences extended in potential bone
RT   marrow donors: B*5804, B*4418, B*1558, and B*4805";
RL   Tissue Antigens 60(2):186-188(2002).
XX
RN   [2]
RP   1-819
RA   Wu J., Bassinger S., Becher M.P., Williams T., Kamoun M., Gourley I.,
RA   Kearns J.;
RT   "Novel human HLA-B alleles identified in potential bone marrow donors";
RL   Unpublished.
XX
RN   [3]
RP   1-819
RA   Wu J., Bassinger S., Becher M.P., Williams T., Kamoun M., Gourley I.,
RA   Kearns J.;
RT   ;
RL   Submitted (28-SEP-1999) to the INSDC.
RL   Pathology, University of New Mexico, 915 Camino de Salud, Albuquerque, NM
RL   87131, USA
XX
CC   On or before Jul 19, 2011 this sequence version replaced
CC   gi:6524982, gi:6524983, gi:6524984, gi:6524985.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..819
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p23"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>819
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1530 variant"
FT   mRNA            join(<1..73,174..443,544..>819)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1530 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,174..443,544..>819)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1530 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q9TP41"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q9TP41"
FT                   /protein_id="AAF15274.1"
FT                   /translation="MRVTAPRTVLLLLSGALALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHNQFAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQWRAYLEGLCVEWLRRYLENGKETLQRA"
FT   exon            <1..73
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1530 variant"
FT                   /number=1
FT   gap             74..173
FT                   /estimated_length=unknown
FT   exon            174..443
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1530 variant"
FT                   /number=2
FT   gap             444..543
FT                   /estimated_length=unknown
FT   exon            544..819
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1530 variant"
FT                   /number=3
XX
SQ   Sequence 819 BP; 119 A; 202 C; 216 G; 82 T; 200 other;
     atgcgggtca cggcgccccg aaccgtcctc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngctccca       180
     ctccatgagg tatttctaca ccgccatgtc ccggcccggc cgcggggagc cccgcttcat       240
     cgcagtgggc tacgtggacg acacccagtt cgtgaggttc gacagcgacg ccgcgagtcc       300
     gaggatggcg ccccgggcgc catggataga gcaggagggg ccggagtatt gggaccggga       360
     gacacagatc tccaagacca acacacagac ttaccgagag agcctgcgga acctgcgcgg       420
     ctactacaac cagagcgagg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnggtctca caccctccag aggatgtacg gctgcgacgt ggggccggac gggcgcctcc       600
     tccgcgggca taaccagttc gcctacgacg gcaaggatta catcgccctg aacgaggacc       660
     tgagctcctg gaccgcggcg gacacggcgg ctcagatcac ccagcgcaag tgggaggcgg       720
     cccgtgaggc ggagcagtgg agagcctacc tggagggcct gtgcgtggag tggctccgca       780
     gatacctgga gaacgggaag gagacgctgc agcgcgcgg                              819
//


spacer
spacer