spacer

EBI Dbfetch

ID   AF184168; SV 1; linear; genomic DNA; STD; HUM; 264 BP.
XX
AC   AF184168;
XX
DT   15-DEC-1999 (Rel. 62, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen DP beta 1 chain (HLA-DPB1) gene, exon 2
DE   and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-264
RA   Malkki M., Petersdorf E.W.;
RT   "A novel HLA-DPB1 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-264
RA   Malkki M., Petersdorf E.W.;
RT   ;
RL   Submitted (08-SEP-1999) to the INSDC.
RL   Human Immunogenetics, Fred Hutchinson Cancer Research Center, 1100 Fairview
RL   Ave N. Mailstop D4-100, Seattle, WA 98109, USA
XX
DR   MD5; c913fed65292c9afa09bbbea72f15f80.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..264
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>264
FT                   /gene="HLA-DPB1"
FT                   /product="MHC class II antigen DP beta 1 chain"
FT   exon            1..264
FT                   /gene="HLA-DPB1"
FT                   /number=2
FT   CDS             <1..>264
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /product="MHC class II antigen DP beta 1 chain"
FT                   /db_xref="GOA:Q9TP05"
FT                   /db_xref="IMGT/HLA:DPB1*85:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9TP05"
FT                   /protein_id="AAF16938.1"
FT                   /translation="NYVYQLRQECYAFNGTQRFLERYIYNREEYARFDSDVGEFRAVTE
FT                   LGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELDEAVTLQHR"
XX
SQ   Sequence 264 BP; 64 A; 65 C; 96 G; 39 T; 0 other;
     agaattacgt gtaccagtta cggcaggaat gctacgcgtt taatgggaca cagcgcttcc        60
     tggagagata catctacaac cgggaggagt acgcgcgctt cgacagcgac gtgggggagt       120
     tccgggcggt gacggagctg gggcggcctg ctgcggagta ctggaacagc cagaaggaca       180
     tcctggagga gaagcgggca gtgccggaca ggatgtgcag acacaactac gagctggacg       240
     aggccgtgac cctgcagcac cgag                                              264
//


spacer
spacer