Dbfetch

ID   AF181983; SV 2; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AF181983;
XX
DT   10-SEP-1999 (Rel. 61, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II DQ beta 1 antigen (HLA-DQB1) gene, HLA-DQB1*0617
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Bassinger S., Wu J., Zhang Q., Brinkema C., Smith A.G., Williams T.M.;
RT   "Novel DQB1*06 alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Bassinger S., Wu J., Zhang Q., Brinkema C., Smith A.G., Williams T.M.;
RT   ;
RL   Submitted (31-AUG-1999) to the INSDC.
RL   Pathology, University of New Mexico, 915 Camino de Salud, NE, Albuquerque,
RL   NM 87131, USA
XX
RN   [3]
RC   Nucleotide and amino acid sequences updated by submitter
RP   1-270
RA   Bassinger S., Wu J., Zhang Q., Brinkema C., Smith A.G., Williams T.M.;
RT   ;
RL   Submitted (20-FEB-2003) to the INSDC.
RL   Pathology, University of New Mexico, 915 Camino de Salud, NE, Albuquerque,
RL   NM 87131, USA
XX
DR   MD5; 63c19af00fd55ea2e05120dae71205ac.
DR   Ensembl-Gn; ENSG00000225824; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231286; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233209; homo_sapiens.
DR   Ensembl-Tr; ENST00000399088; homo_sapiens.
DR   Ensembl-Tr; ENST00000413089; homo_sapiens.
DR   Ensembl-Tr; ENST00000416192; homo_sapiens.
DR   Ensembl-Tr; ENST00000419914; homo_sapiens.
DR   Ensembl-Tr; ENST00000422950; homo_sapiens.
DR   Ensembl-Tr; ENST00000424806; homo_sapiens.
XX
CC   On Feb 20, 2003 this sequence version replaced gi:5853326.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p23.1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>270
FT                   /gene="HLA-DQB1"
FT                   /product="MHC class II DQ beta 1 antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /product="MHC class II DQ beta 1 antigen"
FT                   /note="DQ6 antigen"
FT                   /db_xref="GOA:P01920"
FT                   /db_xref="HGNC:HGNC:4944"
FT                   /db_xref="IMGT/HLA:DQB1*06:17"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1JK8"
FT                   /db_xref="PDB:1NBN"
FT                   /db_xref="PDB:1S9V"
FT                   /db_xref="PDB:1UVQ"
FT                   /db_xref="PDB:2NNA"
FT                   /db_xref="PDB:4GG6"
FT                   /db_xref="PDB:4OZF"
FT                   /db_xref="PDB:4OZG"
FT                   /db_xref="PDB:4OZH"
FT                   /db_xref="PDB:4OZI"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01920"
FT                   /protein_id="AAD54423.2"
FT                   /translation="DFVYQFKGMCYFTNGTERVRLVTRHIYNREEYARFDSDVGVYRAV
FT                   TPQGRPVAEYWNSQKEVLEGARAELDTVCRHNYEVGYRGILQRR"
FT   exon            1..270
FT                   /gene="HLA-DQB1"
FT                   /number=2
XX
SQ   Sequence 270 BP; 59 A; 65 C; 102 G; 44 T; 0 other;
     aggatttcgt gtaccagttt aagggcatgt gctacttcac caacgggacg gagcgcgtgc        60
     gtcttgtaac cagacacatc tataaccgag aggagtacgc gcgcttcgac agcgacgtgg       120
     gggtgtaccg ggcggtgacg ccgcaggggc ggcctgttgc cgagtactgg aacagccaga       180
     aggaagtcct ggagggggcc cgggcggagt tggacacggt gtgcagacac aactacgagg       240
     tggggtaccg cgggatcctg cagaggagag                                        270
//