Dbfetch

ID   AF177216; SV 1; linear; genomic DNA; STD; HUM; 266 BP.
XX
AC   AF177216;
XX
DT   07-SEP-1999 (Rel. 61, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen DRB3 (HLA-DRB3) gene, HLA-DRB3*SSOM
DE   allele, exon 2; and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-266
RA   Greville W.D., Ng G., Kennedy A., Dunckley H.;
RT   "New HLA class II (DRB3) allele detected by sequencing-based typing";
RL   Unpublished.
XX
RN   [2]
RP   1-266
RA   Greville W.D., Ng G., Kennedy A., Dunckley H.;
RT   ;
RL   Submitted (11-AUG-1999) to the INSDC.
RL   Tissue Typing Department, Molecular Genetics Laboratory, Australian Red
RL   Cross Blood Service, 153 Clarence Street, Sydney, NSW 2000, Australia
XX
DR   MD5; 3c1a4b3d32aaf937fff35c6b7a55e4a1.
DR   Ensembl-Gn; ENSG00000196101; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231679; homo_sapiens.
DR   Ensembl-Tr; ENST00000307137; homo_sapiens.
DR   Ensembl-Tr; ENST00000383126; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..266
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="SSOM"
FT                   /db_xref="taxon:9606"
FT   exon            1..266
FT                   /gene="HLA-DRB3"
FT                   /number=2
FT   CDS             <1..>266
FT                   /codon_start=3
FT                   /gene="HLA-DRB3"
FT                   /product="MHC class II antigen DRB3"
FT                   /db_xref="GOA:P79483"
FT                   /db_xref="HGNC:HGNC:4951"
FT                   /db_xref="IMGT/HLA:DRB3*02:02:03"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:2Q6W"
FT                   /db_xref="PDB:3C5J"
FT                   /db_xref="PDB:4H1L"
FT                   /db_xref="UniProtKB/Swiss-Prot:P79483"
FT                   /protein_id="AAD53911.1"
FT                   /translation="RFLELLKSECHFFNGTERVRFLERHFHNQEEYARFDSDVGEYRAV
FT                   RELGRPDAEYWNSQKDLLEQKRGQVDNYCRHNYGVGESFTVQR"
XX
SQ   Sequence 266 BP; 57 A; 61 C; 99 G; 49 T; 0 other;
     cacgtttctt ggagctgctt aagtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga gagacacttc cataaccagg aggagtacgc gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgagg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagaag cggggccagg tggacaatta ctgcaggcac aactacgggg       240
     ttggtgagag cttcacagtg cagcgg                                            266
//