spacer

EBI Dbfetch

ID   AF169239; SV 1; linear; genomic DNA; STD; HUM; 245 BP.
XX
AC   AF169239;
XX
DT   25-AUG-1999 (Rel. 60, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*1338 allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-245
RA   Sintasath D.M., Lin Y.-S., Hurley C.K.;
RT   "Novel HLA-DRB1 alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-245
RA   Sintasath D.M., Lin Y.-S., Hurley C.K.;
RT   ;
RL   Submitted (14-JUL-1999) to the INSDC.
RL   Microbiology and Immunology, Georgetown University, 3970 Reservoir Road,
RL   NW; E404 Research Building, Washington DC 20007, USA
XX
DR   MD5; d1afc3186386b0e8b24d9973f8e3d8a0.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..245
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="031188956"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>245
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   exon            <1..>245
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   CDS             <1..>245
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q5Y7A7"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*13:38"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5Y7A7"
FT                   /protein_id="AAD51315.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAV
FT                   TELGRPSAEYWNSQKDILEDERAAVDTYCRHNYGVG"
XX
SQ   Sequence 245 BP; 53 A; 59 C; 86 G; 47 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctagcgc cgagtactgg aacagccaga       180
     aggacatcct ggaagacgag cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggt                                                                   245
//


spacer
spacer