spacer

EBI Dbfetch

ID   AF159394; SV 1; linear; genomic DNA; STD; ROD; 1144 BP.
XX
AC   AF159394;
XX
DT   17-AUG-1999 (Rel. 60, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Apodemus mystacinus cytochrome b gene, partial cds; mitochondrial gene for
DE   mitochondrial product.
XX
KW   .
XX
OS   Apodemus mystacinus (broad-toothed field mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Apodemus; Sylvaemus group.
OG   Mitochondrion
XX
RN   [1]
RP   1-1144
RX   DOI; 10.1006/mpev.1999.0760.
RX   PUBMED; 10877938.
RA   Martin Y., Gerlach G., Schlotterer C., Meyer A.;
RT   "Molecular phylogeny of European muroid rodents based on complete
RT   cytochrome b sequences";
RL   Mol. Phylogenet. Evol. 16(1):37-47(2000).
XX
RN   [2]
RP   1-1144
RA   Martin Y., Gerlach G., Schloetterer C., Meyer A.;
RT   ;
RL   Submitted (16-JUN-1999) to the INSDC.
RL   Department of Biology, University of Konstanz, Universitaetsstrasse 10,
RL   Konstanz 78457, Germany
XX
DR   MD5; a8283f9ebe55c37c0d8bda1c1894cafd.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1144
FT                   /organism="Apodemus mystacinus"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:100382"
FT   CDS             1..1144
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /transl_except=(pos:1144,aa:TERM)
FT                   /product="cytochrome b"
FT                   /note="TAA stop codon is completed by the addition of 3' A
FT                   residues to the mRNA"
FT                   /db_xref="GOA:Q9TEY5"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9TEY5"
FT                   /protein_id="AAD49239.1"
FT                   /translation="MTNMRKTHPLMKIINHSFIDLPAPSNISSWWNFGSLLGMCLMLQI
FT                   ITGLFLAMHYTSDTMTAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFLHVGRGMYY
FT                   GSYMFMETWNIGIILLFAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIITALVIVHLLFLHETGSNNPTGLNSDADKIPFHP
FT                   YYTIKDILGILLMIMFLMTLVLFFPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALILSILILALLPLLHTSQQRSMIFRPITQTLYWILVANLFILTWIGG
FT                   QPVEHPFIIIGQLASISYFSIILIMMPISGIIEDKMLKWNS"
XX
SQ   Sequence 1144 BP; 364 A; 294 C; 138 G; 348 T; 0 other;
     atgacaaaca tacgtaaaac acatccatta ataaaaatta ttaatcactc atttattgac        60
     ctcccagccc catccaacat ttcctcatga tgaaactttg gatccctact aggaatatgt       120
     ctaatattac aaatcatcac aggcctattt ctagccatac attatacatc agacacaata       180
     acagcatttt catcagtaac acatatttgt cgagacgtaa actacggatg actaatccga       240
     tatttacacg ctaacggagc ttccatattt ttcatctgtt tattcctcca tgtaggacga       300
     ggaatgtact atggatccta catgttcata gaaacatgaa acattggaat tatcctacta       360
     ttcgcagtta tagctacagc atttataggg tatgtacttc catgaggaca gatatccttt       420
     tgaggagcaa cagtaattac aaatctttta tcagctatcc catatatcgg caccactcta       480
     gtagaatgaa tctgaggggg gttctcagta gacaaagcta cactaacacg ctttttcgca       540
     ttccacttta ttctcccatt tattatcacc gccctagtta ttgtccatct attatttctt       600
     cacgaaaccg gatctaataa cccaactggc ctgaattcag acgccgacaa aatcccattc       660
     cacccatact atacaattaa agatatccta ggtattctct tgataattat attcctaata       720
     accctagtcc tattcttccc tgacctttta ggagatccag acaactacac accggccaac       780
     cccctaaata ccccaccaca tatcaaacca gaatgatact ttctatttgc ttacgcaatc       840
     ctacgttcaa tccccaacaa actaggtgga gtcctagccc tcattctatc aatccttatt       900
     ctagctcttc tcccattact ccatacatcc caacaacgaa gtataatctt tcgtccaatt       960
     acacaaacac tctactgaat cctagtagct aacctattta tcctaacttg aattggtggc      1020
     caaccagttg aacacccctt cattatcatc ggccaacttg cttcaattag ctacttctct      1080
     attatcctaa ttataatacc tatctcaggg attatcgaag ataaaatatt aaaatgaaac      1140
     tcat                                                                   1144
//


spacer
spacer