spacer

EBI Dbfetch

ID   AF156987; SV 1; linear; mRNA; STD; MUS; 1793 BP.
XX
AC   AF156987;
XX
DT   02-AUG-1999 (Rel. 60, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus cryptochrome 2 (Cry2) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1793
RX   DOI; 10.1016/S0092-8674(00)81014-4.
RX   PUBMED; 10428031.
RA   Kume K., Zylka M.J., Sriram S., Shearman L.P., Weaver D.R., Jin X.,
RA   Maywood E.S., Hastings M.H., Reppert S.M.;
RT   "mCRY1 and mCRY2 are essential components of the negative limb of the
RT   circadian clock feedback loop";
RL   Cell 98(2):193-205(1999).
XX
RN   [2]
RP   1-1793
RA   Kume K., Reppert S.M.;
RT   ;
RL   Submitted (05-JUN-1999) to the INSDC.
RL   Chronobiology, Massachusetts General Hospital, 32 Fruit Street, Boston, MA
RL   02114, USA
XX
DR   MD5; 25f03121485a4aaec3f82a0af34761a3.
DR   Ensembl-Gn; ENSMUSG00000068742; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000090559; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111278; mus_musculus.
DR   EuropePMC; PMC129793; 12374857.
DR   EuropePMC; PMC1852813; 17400819.
DR   EuropePMC; PMC2383916; 18430226.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1793
FT                   /organism="Mus musculus"
FT                   /strain="C57/BL6"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             15..1793
FT                   /codon_start=1
FT                   /gene="Cry2"
FT                   /product="cryptochrome 2"
FT                   /db_xref="GOA:Q9R194"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="MGI:MGI:1270859"
FT                   /db_xref="PDB:4I6E"
FT                   /db_xref="PDB:4I6G"
FT                   /db_xref="PDB:4I6J"
FT                   /db_xref="PDB:4MLP"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R194"
FT                   /protein_id="AAD46561.1"
FT                   /translation="MAAAAVVAATVPAQSMGADGASSVHWFRKGLRLHDNPALLAAVRG
FT                   ARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPR
FT                   LFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQK
FT                   PPLTYKRFQALISRMELPKKPAVAVSSQQMESCRAEIQENHDDTYGVPSLEELGFPTEG
FT                   LGPAVWQGGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCR
FT                   LFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDR
FT                   NPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVF
FT                   DELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFP
FT                   SRYIYEPWNAPESVQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCL
FT                   LASVPSCVEDLSHPVAEPGSSQAGSISNTGPRALSSGPASPKRKLEAAEEPPGEELTKR
FT                   ARVTEMPTQEPASKDS"
XX
SQ   Sequence 1793 BP; 391 A; 541 C; 519 G; 342 T; 0 other;
     cagtccaggc ggcgatggcg gcggctgctg tggtggcagc gacggtcccc gcgcaatcga        60
     tgggcgcgga cggcgcgtcc tcggtgcact ggttccgcaa aggactacgg ctccacgaca       120
     accccgcgct gctagctgcc gtgcgcgggg cgcgctgtgt gcgctgcgtc tacatcctcg       180
     acccgtggtt cgcggcctcc tcgtctgtgg gcatcaaccg atggaggttc ctactgcaat       240
     ctctggaaga tctggacaca agcttaagaa agctgaattc gcgtctgttt gtagtccggg       300
     gacagccagc tgatgtgttc ccaaggctgt tcaaggaatg gggggtgacc cgtttgacct       360
     ttgaatatga ctctgaaccc tttgggaaag aacgggatgc agccattatg aagatggcca       420
     aggaggctgg cgtggaggtg gtgactgaga actctcacac cctctatgac ctagacagaa       480
     tcatcgaact gaatgggcag aaaccacccc ttacctacaa gcgctttcag gccctcatca       540
     gccgcatgga gctgcccaag aagcccgcgg tggctgtgag cagccagcag atggagagct       600
     gcagagctga gatccaggag aaccatgacg acacctatgg cgtgccttcc ctggaggagc       660
     tgggattccc cacggaagga cttggcccag ctgtttggca aggaggagag acagaagctc       720
     tggcccgcct ggacaagcac ttggaacgga aggcctgggt tgccaactat gagagacctc       780
     ggatgaatgc caattcctta ctggccagcc ccacaggcct cagcccctac ctgcgctttg       840
     gatgcctctc ctgccgcctc ttctactacc gcctgtggga cttgtacaag aaggtgaaga       900
     ggaacagcac accccccctc tccttatttg gacaactcct gtggcgagaa ttcttctaca       960
     cagcggccac caacaacccc aggtttgacc gaatggaggg gaaccccatc tgcatccaga      1020
     tcccctggga ccgcaacccc gaagccctgg ccaagtgggc cgagggcaag acaggcttcc      1080
     cttggattga cgccatcatg acccaactga ggcaggaggg ctggatccac cacctggccc      1140
     ggcacgctgt ggcctgcttc ctcacccgcg gggacctctg ggtcagctgg gagagcgggg      1200
     tccgggtatt tgacgagctg ctcctggatg ccgatttcag tgtgaatgca ggcagctgga      1260
     tgtggctgtc ctgcagtgct ttcttccaac aattcttcca ctgctactgc cctgtgggct      1320
     tcggccgacg tacagacccc agtggggact acatccggcg gtacctgccc aaactgaaag      1380
     gcttcccctc tcgatacatc tatgagccct ggaatgcccc cgagtcagtt cagaaggctg      1440
     ccaagtgcat cattggcgtg gactacccac ggcccatcgt caatcatgca gagactagtc      1500
     ggctcaacat tgaacgaatg aagcagatct accaacagct gtcgagatac cggggactct      1560
     gtctattggc atctgtccct tcctgtgtgg aagacctcag tcaccctgtg gcagagcctg      1620
     gttcaagcca agctgggagc atcagcaaca caggccccag agcactatcc agtggcccag      1680
     cttcccccaa acgcaagctg gaagcagccg aggaacctcc tggtgaagaa ctgaccaagc      1740
     gggctagagt gacggagatg cctacccaag agccagcaag caaggactcc tga             1793
//


spacer
spacer