spacer

EBI Dbfetch

ID   AF156986; SV 1; linear; mRNA; STD; MUS; 2139 BP.
XX
AC   AF156986;
XX
DT   21-JUN-1999 (Rel. 60, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus cryptochrome 1 (Cry1) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2139
RA   Kume K., Reppert S.M.;
RT   "Analysis of mouse cryptochromes";
RL   Unpublished.
XX
RN   [2]
RP   1-2139
RA   Kume K., Reppert S.M.;
RT   ;
RL   Submitted (05-JUN-1999) to the INSDC.
RL   Chronobiology, Mass. General Hosp., 32 Fruit Street, Boston, MA 02114, USA
XX
DR   MD5; 08e012339c04be4bb4fcaca5465d949b.
DR   Ensembl-Gn; ENSMUSG00000020038; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020227; mus_musculus.
DR   EuropePMC; PMC129793; 12374857.
DR   EuropePMC; PMC2383916; 18430226.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2139
FT                   /organism="Mus musculus"
FT                   /strain="C57/black6"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             319..2139
FT                   /codon_start=1
FT                   /gene="Cry1"
FT                   /product="cryptochrome 1"
FT                   /note="CRY1"
FT                   /db_xref="GOA:P97784"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="MGI:MGI:1270841"
FT                   /db_xref="PDB:4CT0"
FT                   /db_xref="PDB:4K0R"
FT                   /db_xref="UniProtKB/Swiss-Prot:P97784"
FT                   /protein_id="AAD39548.1"
FT                   /translation="MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSS
FT                   NVGINRWRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEP
FT                   FGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLVSKMEPL
FT                   EMPADTITSDVIGKCMTPLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLE
FT                   RHLERKAWVANFERPRMNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSS
FT                   PPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWI
FT                   DAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMW
FT                   LSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVA
FT                   KCLIGVNYPKPMVNHAEASRLNIERMKQIYQQLSRYRGLGLLASVPSNSNGNGGLMGYA
FT                   PGENVPSCSSSGNGGLMGYAPGENVPSCSGGNCSQGSGILHYAHGDSQQTHSLKQGRSS
FT                   AGTGLSSGKRPSQEEDAQSVGPKVQRQSSN"
XX
SQ   Sequence 2139 BP; 491 A; 563 C; 585 G; 500 T; 0 other;
     ccccgcgcgc tcgcttgcgc tccgggggtc tcaggccctg gaaggtatgc gtgtcctccg        60
     gacgctgggc gcgggctcct gaaggacgtc gcgcgtggat cccggcgcct cggcagcctc       120
     cattcatctg ccagctgcgc gctcgccacc tccgcgcccc gcctcggcgt cgcctcctcc       180
     cgtcccctct ctgcagccct ttccccactc ctcgggtgag gaggttttct tggaagcgca       240
     ggtgtcggtt atgagcccgg cttccctccc ttgaagctct cggtagagga agtcggggtg       300
     acccgccgcg ccccgagcat gggggtgaac gccgtgcact ggttccgaaa gggactccgg       360
     ctccacgaca accccgccct gaaggagtgc atccagggcg ccgacaccat ccgctgcgtc       420
     tatatcctcg acccctggtt cgccggctct tccaacgtgg gcatcaacag gtggcgattt       480
     ttgcttcagt gtcttgagga tcttgatgcc aatctacgaa aattaaattc tcgtctgttt       540
     gtgattcggg gacagccagc tgatgtattt cccaggcttt tcaaggaatg gaacatcact       600
     aaactctcaa ttgagtatga ttctgagcct tttgggaagg aacgagatgc agctatcaag       660
     aagctggcta ctgaggctgg cgtggaagtc atcgtgcgca tttcacatac actgtatgac       720
     ctggacaaga tcatagaact caatggcgga cagccacctc taacatataa aaggtttcag       780
     actctcgtca gcaagatgga gccactggag atgccagcag acaccatcac atcagatgtg       840
     ataggaaagt gcatgacccc tctgtctgat gaccatgatg agaaatatgg cgttccttcc       900
     ctggaagagc tcggctttga tacagatggc ctgtcctctg cagtgtggcc aggaggagaa       960
     actgaggcac ttacacgttt ggaaaggcat ttggaaagaa aggcctgggt ggcaaacttt      1020
     gaacgacctc gaatgaatgc aaactccctg cttgcaagcc caactggact cagtccttat      1080
     ctccgctttg gttgtttatc atgtcggctg ttttatttca aactaacaga tctctacaaa      1140
     aaggtaaaga agaatagttc ccctcccctt tctctttatg ggcaactcct gtggcgtgaa      1200
     tttttttata cagcagccac aaacaaccca cgctttgaca aaatggaagg gaaccccatc      1260
     tgtgttcaga tcccttggga caagaacccc gaggctctgg ccaaatgggc agaaggccgg      1320
     acaggcttcc cgtggattga cgccatcatg actcagcttc gtcaggaggg ctggatccac      1380
     catttagcca gacacgcggt tgcctgtttc ctgactcgtg gtgacctgtg gatcagctgg      1440
     gaagaaggga tgaaggtctt tgaagagtta ctgcttgatg cagattggag cataaatgct      1500
     ggaagttgga tgtggctgtc ctgcagttcc ttttttcagc aattttttca ctgctactgc      1560
     cctgtgggtt ttggtaggag gacagatccc aatggagact atattaggcg ttatttacct      1620
     gtcctaagag gcttccctgc aaaatatatc tacgatcctt ggaatgcacc agaaggcatc      1680
     cagaaggttg ccaagtgttt gataggagtt aattacccca aaccgatggt gaaccatgct      1740
     gaggcaagca gactgaatat tgaaagaatg aagcagatct atcagcagct ttcccggtac      1800
     agagggctag gtcttctcgc ctcggtccct tctaactcta atgggaatgg agggctcatg      1860
     ggctatgctc ctggagagaa tgtcccgagt tgtagcagca gcgggaatgg agggctcatg      1920
     ggctatgctc ctggagagaa cgtcccgagc tgtagcggtg gaaattgctc tcaaggaagt      1980
     ggtattttac actatgctca cggggacagt cagcagactc actcactcaa gcaagggaga      2040
     agctccgcgg gcaccggcct cagcagtggg aagcgtccta gtcaggaaga ggatgcccag      2100
     agtgtcggcc ccaaagtcca gcggcagagc agtaactga                             2139
//


spacer
spacer